Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01256

ProSeqID PSQ01256
Family FND00053
Protein Name Ceratotoxin-A
UniProt ID P36190
Taxonomy Eukaryota-Metazoa-Ecdysozoa-Arthropoda-Hexapoda-Insecta-Pterygota-Neoptera-Holometabola-Diptera-Brachycera-Muscomorpha-Tephritoidea-Tephritidae-Ceratitis-Ceratitis
Organisms Ceratitis capitata (Mediterranean fruit fly) (Tephritis capitata)
Prosequence Length (aa) 12
Functions None
Preproprotein Length (aa) 71
Alt Name None
Gene Name CTXA1
NCBI ID 7213
Cellular Localization extracellular region
Processes defense response to bacterium, hemolysis in other organism, innate immune response
PubMed 8353519
Total Prosequence Length (aa) 12
Prosequence Location 24:35
Prosequence Sequence EPAAEDSVVVKR
Preproprotein Sequence MANLKAVFLICIVAFIALQCVVAEPAAEDSVVVKRSIGSALKKALPVAKKIGKIALPIAKAALPVAAGLVG