Details of PSQ01256
| ProSeqID |
PSQ01256 |
| Family |
FND00053 |
| Protein Name |
Ceratotoxin-A |
| UniProt ID |
P36190
|
| Taxonomy |
Eukaryota-Metazoa-Ecdysozoa-Arthropoda-Hexapoda-Insecta-Pterygota-Neoptera-Holometabola-Diptera-Brachycera-Muscomorpha-Tephritoidea-Tephritidae-Ceratitis-Ceratitis |
| Organisms |
Ceratitis capitata (Mediterranean fruit fly) (Tephritis capitata) |
| Prosequence Length (aa) |
12 |
| Functions |
None |
| Preproprotein Length (aa) |
71 |
| Alt Name |
None |
| Gene Name |
CTXA1 |
| NCBI ID |
7213 |
| Cellular Localization |
extracellular region |
| Processes |
defense response to bacterium, hemolysis in other organism, innate immune response |
| PubMed |
8353519
|
| Total Prosequence Length (aa) |
12 |
| Prosequence Location |
24:35 |
| Prosequence Sequence |
EPAAEDSVVVKR |
| Preproprotein Sequence |
MANLKAVFLICIVAFIALQCVVAEPAAEDSVVVKRSIGSALKKALPVAKKIGKIALPIAKAALPVAAGLVG |