Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
Preproprotein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Download whole result Csv
Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions Preproprotein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ01451 FD00090 Clavanin-D P80713 Eukaryota Metazoa Chordata Tunicata Ascidiacea Stolidobranchia Styelidae Styela Styela clava (Sea squirt) 10 None 80 None None 7725 extracellular region defense response to bacterium 9001389 10 20:29 LEERKSEEEK
PSQ01452 FD00179 Superoxide dismutase P80734 Bacteria Actinobacteria Streptomycetales Streptomycetaceae Streptomyces Streptomyces seoulensis 14 nickel cation binding, superoxide dismutase activity 131 NiSOD, Nickel-containing superoxide dismutase sodN 73044 cytoplasm None 8836134 14 1:14 MLSRLFAPKVKVSA
PSQ01453 FD00179 Superoxide dismutase P80735 Bacteria Actinobacteria Streptomycetales Streptomycetaceae Streptomyces Streptomyces albidoflavus group Streptomyces coelicolor (strain ATCC BAA-471 14 nickel cation binding, superoxide dismutase activity 131 NiSOD, Nickel-containing superoxide dismutase sodN 100226 cytoplasm None 8836134, 8898904 14 1:14 MLSRLFAPKVTVSA
PSQ01454 FD00012 Ananain P80884 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida Liliopsida Poales Bromeliaceae Bromelioideae Ananas Ananas comosus (Pineapple) (Ananas ananas) 98 cysteine-type peptidase activity 345 None AN1 4615 None None 9355753 98 25:122 SCDEPSDPMMKQFEEWMAEYGRVYKDNDEKMLRFQIFKNNVNHIETFNNRNGNSYTLGINQFTDMTNNEFVAQYTGLSLPLNIKREPVVSFDDVDISS
PSQ01455 FD00010 Acidic phospholipase A2 1 P80966 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Elapidae Elapinae Ophiophagus Ophiophagus hannah (King cobra) (Naja hannah) 6 calcium ion binding, phospholipase A2 activity, phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine), phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine), toxin activity 151 APLA2-1, OHV A-PLA2, Phosphatidylcholine 2-acylhydrolase None 8665 extracellular region arachidonic acid secretion, lipid catabolic process, phospholipid metabolic process 9028866 6 22:27 IPPQPL
PSQ01456 FD00384 Peptidyl-Lys metalloendopeptidase P81054 Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Polyporales Grifolaceae Grifola Grifola frondosa (Maitake) (Polyporus frondosus) 163 metal ion binding, metalloendopeptidase activity 348 GfMEP MEP 5627 extracellular region None 8749321, 9374478 163 19:181 NPGLSLKVSGPEAVDGVNNLKVVTTITNTGDETLKLLNDPRGALHTMPTDTFAITNESGETPSFIGVKVKYVPSMAAKSTGENVFAVIAPGQSVNVEHDLSAAYNFTSSGAGTYALEALNVFNYIDPETNEPVEIWADAEAHTTAVSGKLAVVRATPTLTRPV
PSQ01457 FD00040 Zinc metalloproteinase aureolysin P81177 Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus 182 metal ion binding, metalloendopeptidase activity 509 Staphylococcus aureus neutral proteinase aur 1280 None None 9753696 182 28:209 SDTNHKPATSDINFEITQKSDAVKALKELPKSENVKNHYQDYSVTDVKTDKKGFTHYTLQPSVDGVHAPDKEVKVHADKSGKVVLINGDTDAKKVKPTNKVTLSKDEAADKAFNAVKIDKNKAKNLQDDVIKENKVEIDGDSNKYIYNIELITVTPEISHWKVKIDADTGAVVEKTNLVKEA
PSQ01458 FND00203 Beta-1,3-glucan-binding protein P81182 Eukaryota Metazoa Ecdysozoa Arthropoda Crustacea Multicrustacea Malacostraca Eumalacostraca Eucarida Decapoda Dendrobranchiata Penaeoidea Penaeidae Penaeus Penaeus vannamei (Whiteleg shrimp) (Litopenaeus vannamei) 197 pattern recognition receptor activity 1454 Beta-1, BetaGBP-HDL, High density lipoprotein None 6689 extracellular region cell surface pattern recognition receptor signaling pathway, innate immune response, lipid transport, regulation of innate immune response 9149399 197 1:197 MSFDLTTPFDVIKTVSLSARYSWTTSQKGATLNITYNDKNFVLSSSLQLSTRASNITFQATTPFEGFQNSFIEIKYDIDNREELLASRVSVDDHSYSFVVGGYIEDKLAVFKWNLNSPLTGWTDAKFVAKIDLSSENKNLEISLEKEGDLKAIAVSGKFIGSTLDFNLRTPFRGLNNFNVFGSLNRSKRSLEMRMMN
PSQ01459 FD00332 Nuclease P81204 Eukaryota Fungi Fungi incertae sedis Mucoromycota Mucoromycotina Mucoromycetes Mucorales Syncephalastraceae Syncephalastrum Syncephalastrum racemosum (Filamentous fungus) 200 endonuclease activity, metal ion binding, nucleic acid binding 320 Sr-nuclease None 13706 extracellular region None 10191256, 8489265 200 70:269 RASSDILKLGNPGPVSDLLERSGYILSYNRRDRLAHWVGEHLTSASLQAGQGVDRDKSNFQEDTDIPEMFRAHLKDYVSSGYDRGHQAPAADDLSSQEAMDETFLLSNMAPQVGVGFNRHYWAYLEGFMRDLTQNFTDVYVYTGPLFLPSAASTGRKNPAYSIEYPFLGATTPNVPVPTHFFKIALTTTASSEYALGAFV
PSQ01460 FD00157 Minor fimbrium subunit Mfa1 P81363 Bacteria Bacteroidetes Bacteroidia Bacteroidales Porphyromonadaceae Porphyromonas Porphyromonas gingivalis 31 None 498 53 kDa major outer membrane protein mfa1 837 cell outer membrane, outer membrane, pilus shaft cell-cell adhesion, pathogenesis 8208139 31 20:50 CSKEGNGPAPDSSSTADTHMSVSMSLPQHNR
PSQ01461 FD00017 Venom prothrombin activator trocarin-D P81428 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Elapidae Notechinae Tropidechis Tropidechis carinatus (Australian rough-scaled snake) 20, 28 calcium ion binding, peptidase activator activity, serine-type endopeptidase activity, toxin activity 455 Venom coagulation factor Xa-like protease None 100989 extracellular region blood coagulation, envenomation resulting in positive regulation of blood coagulation in other organism, positive regulation of blood coagulation in other organism 10397729;10397729 48 21:40, 182:209 ESNVFLKSKVANRFLQRTKR, REASLPDFVQSQKATLLKKSDNPSPDIR
PSQ01462 FD00093 Beta-galactoside-specific lectin 1 P81446 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae Santalales Viscaceae Viscum Viscum album (European mistletoe) 14 carbohydrate binding, rRNA N-glycosylase activity, toxin activity 564 Beta-galactoside-specific lectin I, Viscumin None 3972 None defense response, negative regulation of translation 9618256 14 288:301 DVRYWPLVIRPVIA
PSQ01463 FD00378 Protein-glutamine gamma-glutamyltransferase P81453 Bacteria Actinobacteria Streptomycetales Streptomycetaceae Streptomyces Streptomyces mobaraensis (Streptoverticillium mobaraense) 45 protein-glutamine gamma-glutamyltransferase activity 407 MTG, Transglutaminase None 35621 None None 8099353 45 32:76 DNGAGEETKSYAETYRLTADDVANINALNESAPAASSAGPSFRAP
PSQ01464 FND00004 Dermaseptin-B4 P81486 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Phyllomedusa Phyllomedusa bicolor (Two-colored leaf frog) (Rana bicolor) 21 None 76 Dermaseptin BIV None 8393 extracellular region defense response to bacterium, innate immune response 9614066 21 23:43 EEEKRENKDEIEQEDDEQSEE
PSQ01465 FND00004 Dermaseptin-B6 P81490 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Phyllomedusa Phyllomedusa bicolor (Two-colored leaf frog) (Rana bicolor) 21 None 72 Dermaseptin BVI None 8393 extracellular region defense response to bacterium 9614066 21 23:43 EEEKRENEDEMEQEDDEQSEE
PSQ01466 FD00132 Skin calcitonin gene-related peptide P81564 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Phyllomedusa Phyllomedusa bicolor (Two-colored leaf frog) (Rana bicolor) 44 hormone activity 120 None None 8393 extracellular region None 10681586 44 26:69 APARRALEPLPDRVTEAHRLLRALIRELTAEDMEASSSGAAHKR
PSQ01467 FND00038 Phylloxin-B1 P81565 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Phyllomedusa Phyllomedusa bicolor (Two-colored leaf frog) (Rana bicolor) 20 None 64 Phylloxin PLX-B 8393 extracellular region defense response to bacterium, innate immune response 10632707 20 23:42 EENKREEHEEIEENKEKAEE
PSQ01468 FD00031 Defensin-B P81602 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Nematocera Culicoidea Culicidae Culicinae Aedini Aedes Stegomyia Aedes aegypti (Yellowfever mosquito) (Culex aegypti) 38 None 98 None DEFB 7159 extracellular region defense response to bacterium, innate immune response 7633471 38 21:58 YPQEPVLADEARPFANSLFDELPEETYQAAVENFRLKR
PSQ01469 FD00444 Dermcidin P81605 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 13 peptidase activity, RNA binding 110 Preproteolysin DCD 9606 extracellular exosome, extracellular region, extracellular space antimicrobial humoral immune response mediated by antimicrobial peptide, antimicrobial humoral response, defense response to bacterium, defense response to fungus, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, killing by host of symbiont cells, killing of cells of other organism 11694882 13 50:62 GLARQAPKPRKQR
PSQ01470 FD00133 Toxin CSTX-1 P81694 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Lycosoidea Ctenidae Cupiennius Cupiennius salei (American wandering spider) 27 toxin activity 122 Omega-ctenitoxin-Cs1a None 6928 extracellular region, integral component of membrane, other organism cell membrane cytolysis 10897091, 8016851 27 21:47 EIEDDFLEDESFEAEDIIPFFENEQAR
PSQ01471 FD00014 Epsilon-conotoxin TxVA P81755 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Cylinder Conus textile (Cloth-of-gold cone) 31 toxin activity 67 Epsilon-TxIX , Tx-012 , Tx5, tx5a None 6494 extracellular region None 10318957, 10521453, 10679974 31 20:50 FDARTKTDDDVPLSSLRDNLKRTIRTRLNIR
PSQ01472 FND00292 Omega-ctenitoxin-Pn4a P81792 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Lycosoidea Ctenidae Phoneutria Phoneutria nigriventer (Brazilian armed spider) (Ctenus nigriventer) 13 toxin activity 90 CTK 01512-2 , Neurotoxin Tx3-6 , Ph-alpha-1-beta toxin None 6918 extracellular region None 16278100, 8446961 13 22:34 EEEPDSDALVPQE
PSQ01473 FND00081 Prothoracicostatic peptide P82003 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Lepidoptera Glossata Ditrysia Bombycoidea Bombycidae Bombycinae Bombyx Bombyx mori (Silk moth) 48 hormone activity 274 Bom-PTSP None 7091 extracellular space instar larval development 10531308 48 20:67 AEEPHHDAAPQTDNEVDLTEDDKRAWSSLHSGWAKRAWQDMSSAWGKR
PSQ01474 FD00023 Cathelicidin-2 P82018 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Caprinae Capra Capra hircus (Goat) 101 None 180 Bactenecin-5, ChBac5 CATHL2 9925 extracellular region defense response to bacterium 10417180 101 30:130 QALSYREAVLRAVGQLNERSSEANLYRLLELDPAPNDEVDPGTRKPVSFTVKETVCPRTTQQPPEECDFKENGLVKQCVGTVTLDPSNDQFDINCNELQSV
PSQ01475 FD00022 Rhesus theta defensin-1 P82270 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Cercopithecidae Cercopithecinae Macaca Macaca mulatta (Rhesus macaque) 42 None 76 Demidefensin-2, RTD-3 RTD1A 9544 extracellular space antibacterial humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, cellular response to lipopolysaccharide, defense response to fungus, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, innate immune response in mucosa, killing of cells of other organism, membrane disruption in other organism 10521339 42 23:64 RQARADEAAAQQQPGTDDQGMAHSFTWPENAALPLSESAKGL
PSQ01476 FD00022 Rhesus theta defensin-1 P82271 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Cercopithecidae Cercopithecinae Macaca Macaca mulatta (Rhesus macaque) 42 None 76 Demidefensin-1, RTD-2 RTD1B 9544 extracellular space antibacterial humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, cellular response to lipopolysaccharide, defense response to fungus, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, innate immune response in mucosa, killing of cells of other organism, membrane disruption in other organism 10521339 42 23:64 RQARADEAAAQQQPGADDQGMAHSFTRPENAALPLSESARGL
PSQ01477 FD00022 Neutrophil defensin 4 P82319 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Cercopithecidae Cercopithecinae Macaca Macaca mulatta (Rhesus macaque) 42 None 94 RMAD-4 None 9544 extracellular space antibacterial humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, cellular response to lipopolysaccharide, defense response to fungus, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, innate immune response in mucosa, killing of cells of other organism, membrane disruption in other organism 10531277 42 20:61 KSLQETADDAATQEQPGEDDQDLAVSFEENGLSTLRASGSQA
PSQ01478 FD00022 Neutrophil defensin 6 P82320 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Cercopithecidae Cercopithecinae Macaca Macaca mulatta (Rhesus macaque) 42 None 94 RMAD-6 None 9544 extracellular space antibacterial humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, cellular response to lipopolysaccharide, defense response to fungus, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, innate immune response in mucosa, killing of cells of other organism, membrane disruption in other organism 10531277 42 20:61 KSLQETADEAATQEQPGEDDQDLAVSFEENGLSTLRASGSQA
PSQ01479 FND00014 Aurein-2 P82389 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Pelodryadinae Ranoidea Ranoidea aurea (Green and golden bell frog) (Litoria aurea) 27 None 72 None None 8371 extracellular region, membrane, other organism cell membrane defense response to bacterium, innate immune response 10951191 27 23:49 EKEKRQNEEDEDENEAANHEEGSEEKR
PSQ01480 FND00014 Aurein-2 P82390 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Pelodryadinae Ranoidea Ranoidea aurea (Green and golden bell frog) (Litoria aurea) 27 None 72 None None 8371 extracellular region, membrane, other organism cell membrane defense response to bacterium, innate immune response 10951191 27 23:49 EKEKRQNGEDEDENEAANHEEGSEEKR
PSQ01481 FD00018 Disintegrin EC6 subunit alpha P82465 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Viperinae Echis Echis carinatus sochureki (Saw-scaled viper) 27 toxin activity 120 None None 124223 extracellular region None 10926928 27 21:47 IILESGNINDYEIVYPKKVAVLPTGAM
PSQ01482 FD00483 Chitin deacetylase 3 P82476 Eukaryota Fungi Dikarya Basidiomycota Agaricomycotina Tremellomycetes Tremellales Cryptococcaceae Cryptococcus Cryptococcus neoformans species complex Cryptococcus neoformans var, CBS 10515 21 chitin binding, chitin deacetylase activity, metal ion binding 419 None CDA3 235443 anchored component of membrane, extracellular region, fungal-type cell wall, plasma membrane cell wall chitin catabolic process, cell wall organization, fungal-type cell wall biogenesis, polysaccharide catabolic process 10749672 21 19:39 APFRESWLQPRDSPVSQLFRR
PSQ01483 FD00356 Chorion peroxidase P82600 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Nematocera Culicoidea Culicidae Culicinae Aedini Aedes Stegomyia Aedes aegypti (Yellowfever mosquito) (Culex aegypti) 193 heme binding, metal ion binding, peroxidase activity 790 None pxt 7159 extracellular region eggshell chorion assembly, hydrogen peroxide catabolic process, hydrogen peroxide metabolic process, response to oxidative stress 10871050, 16150691 193 17:209 TWFGFGYVQCKLPTSRSEIPNFDYTVAQQPDQSDACEQNEVCMVSVECILDAKKKAILKPCSTVPSVDGVCCPSSEYNGTSSRVQQNSEEHAADHLVLQAIHEGRREYDEKLRFEDEHRAVMTAKEKPEAMFHRMFLPGGLKTHGKEVVDAEEQANVYGHVFASRKYAELTNMTLKQRQGDRFARIPRAIRKR
PSQ01484 FD00093 Beta-galactoside-specific lectin 3 P82683 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae Santalales Viscaceae Viscum Viscum album (European mistletoe) 20 carbohydrate binding, rRNA N-glycosylase activity, toxin activity 569 Beta-galactoside-specific lectin II, Beta-galactoside-specific lectin III None 3972 None defense response, negative regulation of translation 15635663 20 288:307 EVRYWPLVIRPVLENSGAVD
PSQ01485 FND00157 Daisho1 P82705 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 6 None 42 Immune-induced peptide 4 Dso1 7227 extracellular region, extracellular space cell morphogenesis, defense response, humoral immune response, innate immune response, positive regulation of antifungal innate immune response, response to bacterium, Toll signaling pathway 12171930, 9736738 6 21:26 EPVPQP
PSQ01486 FD00556 Bomanin Short 1 P82706 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 7 None 45 Bomanin-1 , Immune-induced peptide 1 BomS1 7227 extracellular region defense response, innate immune response, response to bacterium 9736738 7 21:27 VPLSPDP
PSQ01487 FD00274 Hepcidin P82951 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Actinopterygii Neopterygii Teleostei Neoteleostei Acanthomorphata Eupercaria Moronidae Morone Morone chrysops x Morone saxatilis (White bass x Striped bass) 40 hormone activity 85 None hamp 45352 extracellular region cellular iron ion homeostasis, defense response to bacterium 11985602 40 25:64 VPVTEVQELEEPMSNEYQEMPVESWKMPYNNRHKRHSSPG
PSQ01488 FND00003 U1-theraphotoxin-Hs1a P82959 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma Cyriopagopus schmidti (Chinese bird spider) (Haplopelma schmidti) 26 toxin activity 85 Huwentoxin-2 form 1, Huwentoxin-II None 29017 extracellular region, host cell postsynaptic membrane pathogenesis 10424342 26 23:48 EELEAESQLMEVGMPDTELAAVDEER
PSQ01489 FD00005 Maximins 1 P83080 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 50 toxin activity 144 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 50 74:123 TAEEHEVMKRLEAVMRDLDSLDYPEEAAERETRSFNQEEIANLFTKKEKR
PSQ01490 FD00111 Maximins 2 P83081 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 50 None 144 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 50 74:123 TAEDHEVMKRLEAVMRDLDSLDYPEEAAERETRGFNQEEIANLFTKKEKR
PSQ01491 FD00005 Maximins 3 P83082 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 25, 50 toxin activity 144 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991;11835991 75 19:43, 74:123 RSVQNDEQSLSQRDVLEEESLREIR, TAEEHEVMKRLEAVMRDLDSLDYPEEASERETRGFNQDEIANLFTKKEKR
PSQ01492 FD00005 Maximins 4 P83083 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 25, 50 None 144 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991;11835991 75 19:43, 74:123 RSEEKDVQSLSQRDVLEEESLREIR, TAEDHEVMKRLEAVMRDLDSLDHPEEASERETRGFNQEEIANLFTKKEKR
PSQ01493 FD00005 Maximins 5 P83084 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 25, 51 None 145 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991;11835991 76 19:43, 74:124 RSVQNDEQSLSQRDVLEEESLREIR, TAEEQHEVMKRLEAVMRDLDSLDHPEEASEREIRGFNQEEIANLFTKKEKR
PSQ01494 FD00082 Cathepsin B P83205 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Caprinae Ovis Ovis aries (Sheep) 60 cysteine-type endopeptidase activity, endopeptidase activity 335 Cathepsin B1 CTSB 9940 apical plasma membrane, external side of plasma membrane, extracellular space, lysosome, melanosome decidualization, proteolysis involved in cellular protein catabolic process, regulation of catalytic activity, thyroid hormone generation, viral entry into host cell 12506352 60 20:79 SLHFPPLSDEMVNYVNKQNTTWKAGHNFYNVDLSYVKKLCGAILGGPKLPQRDAFAADMV
PSQ01495 FND00237 Natriuretic peptide TNP-b P83228 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Elapidae Acanthophiinae Oxyuranus Oxyuranus scutellatus scutellatus (Australian taipan) (Coastal taipan) 44 hormone activity, toxin activity 118 Taipan natriuretic peptide, Venom natriuretic peptide OxsSNPb None 8667 extracellular region regulation of blood pressure, vasodilation 15652496 44 28:71 KPAPLPQALPEALAGGTTALRRDVTEEQQQQLVAEESSGPAAGR
PSQ01496 FD00018 Disintegrin lebein-1-alpha P83253 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Viperinae Macrovipera Macrovipera lebetina (Levantine viper) (Vipera lebetina) 27 toxin activity 118 ML-3, MS-II, Platelet aggregation activation inhibitor None 8709 extracellular region cell adhesion, negative regulation of blood coagulation 11343790, 12719418, 16411889 27 21:47 IILESGNVNDYEIVYPKKVTVLPTGAM
PSQ01497 FND00082 Omega-oxotoxin-Ot1a P83288 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Lycosoidea Oxyopidae Oxyopes Oxyopes takobius (Lynx spider) (Oxyopes foliiformis) 38 toxin activity 123 Oxytoxin-1 , Tx-1 None 666126 extracellular region None 11976325 38 17:54 TYLSEQDVNEVSEFLEALDQANEAASEMVEAAETEEAR
PSQ01498 FD00001 Huwentoxin-IV P83303 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Haplopelma Cyriopagopus schmidti (Chinese bird spider) (Haplopelma schmidti) 28 ion channel inhibitor activity, toxin activity 89 Huwentoxin-4 , Huwentoxin-IVa , Huwentoxin-IVb , Huwentoxin-IVc , Mu-theraphotoxin-Hs2a None 29017 extracellular region pathogenesis 12228241 28 25:52 SESEEKEFSNELLSSVLAVDDNSKGEER
PSQ01499 FD00017 Venom prothrombin activator hopsarin-D P83370 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Elapidae Notechinae Hoplocephalus Hoplocephalus stephensii (Stephens 28 calcium ion binding, peptidase activator activity, serine-type endopeptidase activity, toxin activity 455 Venom coagulation factor Xa-like protease None 196418 extracellular region blood coagulation, envenomation resulting in positive regulation of blood coagulation in other organism, positive regulation of blood coagulation in other organism 12403650 28 182:209 REASLPDFVQSQKATLLKKSDNPSPDIR
PSQ01500 FD00031 Defensin P83404 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Nematocera Psychodoidea Psychodidae Phlebotomus Phlebotomus Phlebotomus duboscqi (Sandfly) 39 None 98 None None 37738 extracellular region defense response to fungus, defense response to Gram-positive bacterium, innate immune response, killing of cells of other organism 15557638 39 20:58 YPSNPVEVEAEDFDAQDPDLQTFQDTFYEVPQVHSRQKR
Total Pages 43
Go to Lab Web Page