| ProSeqID | PSQ01286 |
| Family | FD00538 |
| Protein Name | Drosomycin |
| UniProt ID | P41964 |
| Taxonomy | Eukaryota-Metazoa-Ecdysozoa-Arthropoda-Hexapoda-Insecta-Pterygota-Neoptera-Holometabola-Diptera-Brachycera-Muscomorpha-Ephydroidea-Drosophilidae-Drosophila-Sophophora |
| Organisms | Drosophila melanogaster (Fruit fly) |
| Prosequence Length (aa) | 6 |
| Functions | None |
| Preproprotein Length (aa) | 70 |
| Alt Name | Cysteine-rich peptide |
| Gene Name | Drs |
| NCBI ID | 7227 |
| Cellular Localization | extracellular space |
| Processes | antibacterial humoral response, antifungal humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, defense response, defense response to fungus, defense response to Gram-negative bacterium, defense response to protozoan, killing of cells of other organism, response to bacterium, response to wounding |
| PubMed | 7806546 |
| Total Prosequence Length (aa) | 6 |
| Prosequence Location | 21:26 |
| Prosequence Sequence | ANEADA |
| Preproprotein Sequence | MMQIKYLFALFAVLMLVVLGANEADADCLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCEGC |