Details of PSQ01289
| ProSeqID |
PSQ01289 |
| Family |
FD00558 |
| Protein Name |
Cell death protein 3 |
| UniProt ID |
P42573
|
| Taxonomy |
Eukaryota-Metazoa-Ecdysozoa-Nematoda-Chromadorea-Rhabditida-Rhabditina-Rhabditomorpha-Rhabditoidea-Rhabditidae-Peloderinae-Caenorhabditis |
| Organisms |
Caenorhabditis elegans |
| Prosequence Length (aa) |
221 |
| Functions |
cysteine-type endopeptidase activator activity involved in apoptotic process, cysteine-type endopeptidase activity, cysteine-type endopeptidase activity involved in apoptotic process, cysteine-type endopeptidase activity involved in apoptotic signaling pathway, cysteine-type endopeptidase activity involved in execution phase of apoptosis, endopeptidase activity, identical protein binding |
| Preproprotein Length (aa) |
503 |
| Alt Name |
Caspase ced-3 |
| Gene Name |
ced-3 |
| NCBI ID |
6239 |
| Cellular Localization |
caspase complex, cytoplasm, membrane, mitochondrion, neuronal cell body, nuclear membrane, perikaryon, perinuclear region of cytoplasm, presynapse |
| Processes |
actin filament depolymerization, activation of cysteine-type endopeptidase activity, activation of cysteine-type endopeptidase activity involved in apoptotic process, apoptotic process, apoptotic process involved in development, defense response to Gram-negative bacterium, embryo development ending in birth or egg hatching, execution phase of apoptosis, muscle cell cellular homeostasis, negative regulation of cellular response to manganese ion, positive regulation of apoptotic process involved in development, positive regulation of cellular response to gamma radiation, positive regulation of neuron apoptotic process, positive regulation of oviposition, positive regulation of protein processing, positive regulation of synapse pruning, programmed cell death, protein autoprocessing, protein catabolic process, proteolysis, regulation of cell adhesion, regulation of cell fate specification, regulation of development, heterochronic, regulation of locomotion, regulation of protein stability, regulation of synapse organization, regulation of vulval development |
| PubMed |
8654923
|
| Total Prosequence Length (aa) |
221 |
| Prosequence Location |
1:221 |
| Prosequence Sequence |
MMRQDRRSLLERNIMMFSSHLKVDEILEVLIAKQVLNSDNGDMINSCGTVREKRREIVKAVQRRGDVAFDAFYDALRSTGHEGLAEVLEPLARSVDSNAVEFECPMSPASHRRSRALSPAGYTSPTRVHRDSVSSVSSFTSYQDIYSRARSRSRSRALHSSDRHNYSSPPVNAFPSQPSSANSSFTGCSSLGYSSSRNRSFSKASGPTQYIFHEEDMNFVD |
| Preproprotein Sequence |
MMRQDRRSLLERNIMMFSSHLKVDEILEVLIAKQVLNSDNGDMINSCGTVREKRREIVKAVQRRGDVAFDAFYDALRSTGHEGLAEVLEPLARSVDSNAVEFECPMSPASHRRSRALSPAGYTSPTRVHRDSVSSVSSFTSYQDIYSRARSRSRSRALHSSDRHNYSSPPVNAFPSQPSSANSSFTGCSSLGYSSSRNRSFSKASGPTQYIFHEEDMNFVDAPTISRVFDEKTMYRNFSSPRGMCLIINNEHFEQMPTRNGTKADKDNLTNLFRCMGYTVICKDNLTGRGMLLTIRDFAKHESHGDSAILVILSHGEENVIIGVDDIPISTHEIYDLLNAANAPRLANKPKIVFVQACRGERRDNGFPVLDSVDGVPAFLRRGWDNRDGPLFNFLGCVRPQVQQVWRKKPSQADILIAYATTAQYVSWRNSARGSWFIQAVCEVFSTHAKDMDVVELLTEVNKKVACGFQTSQGSNILKQMPEMTSRLLKKFYFWPEARNSAV |
