Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01294

ProSeqID PSQ01294
Family FD00132
Protein Name Pro-adrenomedullin
UniProt ID P43145
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Rattus
Organisms Rattus norvegicus (Rat)
Prosequence Length (aa) 47, 36
Functions adrenomedullin receptor binding, hormone activity
Preproprotein Length (aa) 185
Alt Name None
Gene Name Adm
NCBI ID 10116
Cellular Localization cytoplasm, extracellular space
Processes adenylate cyclase-activating G protein-coupled receptor signaling pathway, adrenomedullin receptor signaling pathway, aging, amylin receptor signaling pathway, androgen metabolic process, animal organ regeneration, branching involved in labyrinthine layer morphogenesis, calcium ion homeostasis, cAMP-mediated signaling, developmental growth, female pregnancy, G protein-coupled receptor internalization, heart development, hormone secretion, negative regulation of cell population proliferation, negative regulation of vascular permeability, negative regulation of vasoconstriction, neural tube closure, neuron projection regeneration, odontogenesis of dentin-containing tooth, positive regulation of angiogenesis, positive regulation of apoptotic process, positive regulation of cell population proliferation, positive regulation of cytosolic calcium ion concentration, positive regulation of heart rate, positive regulation of vasculogenesis, receptor internalization, regulation of systemic arterial blood pressure, regulation of the force of heart contraction, regulation of urine volume, response to cold, response to glucocorticoid, response to hypoxia, response to insulin, response to lipopolysaccharide, response to organic substance, response to starvation, response to wounding, spongiotrophoblast layer development, vascular associated smooth muscle cell development, vasculogenesis
PubMed 2647977626479776
Total Prosequence Length (aa) 83
Prosequence Location 45:91, 150:185
Prosequence Sequence ELQASSSYPTGLVDEKTVPTQTLGLQDKQSTSSTPQASTQSTAHIRV, SLPEVLRARTVESSQEQTHSAPASPAHQDISRVSRL
Preproprotein Sequence MKLVSIALMLLGSLAVLGADTARLDTSSQFRKKWNKWALSRGKRELQASSSYPTGLVDEKTVPTQTLGLQDKQSTSSTPQASTQSTAHIRVKRYRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGYGRRRRRSLPEVLRARTVESSQEQTHSAPASPAHQDISRVSRL