Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01292

ProSeqID PSQ01292
Family FD00397
Protein Name Platelet basic protein
UniProt ID P43030
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Laurasiatheria-Artiodactyla-Suina-Suidae-Sus
Organisms Sus scrofa (Pig)
Prosequence Length (aa) 6
Functions chemokine activity, CXCR chemokine receptor binding, growth factor activity
Preproprotein Length (aa) 120
Alt Name C-X-C motif chemokine 7, Small-inducible cytokine B7
Gene Name PPBP
NCBI ID 9823
Cellular Localization extracellular space
Processes antimicrobial humoral immune response mediated by antimicrobial peptide, cellular response to lipopolysaccharide, chemokine-mediated signaling pathway, inflammatory response, neutrophil chemotaxis, positive regulation of cell division
PubMed 7513641
Total Prosequence Length (aa) 6
Prosequence Location 34:39
Prosequence Sequence VPATMG
Preproprotein Sequence MSLRLGAISSCTTSSPFPVLQVLLPLSLLLTTLVPATMGAAKIEGRMAHVELRCLCLNTVSGIHPSNIQSLEVIRAGAHCAKVEVIATLKNDKKICLDPEAPRIKKIVQKIMEDGGSAA