Details of PSQ00838
| ProSeqID |
PSQ00838 |
| Family |
FD00096 |
| Protein Name |
Somatoliberin |
| UniProt ID |
P09916
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Rattus |
| Organisms |
Rattus norvegicus (Rat) |
| Prosequence Length (aa) |
11 |
| Functions |
growth hormone-releasing hormone activity, growth hormone-releasing hormone receptor binding, neuropeptide hormone activity, peptide hormone receptor binding |
| Preproprotein Length (aa) |
104 |
| Alt Name |
Growth hormone-releasing factor, Growth hormone-releasing hormone |
| Gene Name |
Ghrh |
| NCBI ID |
10116 |
| Cellular Localization |
axon terminus, extracellular space, neuron projection, perikaryon, terminal bouton |
| Processes |
adenohypophysis development, adenylate cyclase-activating G protein-coupled receptor signaling pathway, adenylate cyclase-modulating G protein-coupled receptor signaling pathway, cellular response to interleukin-6, circadian sleep/wake cycle, non-REM sleep, growth hormone secretion, negative regulation of cardiac muscle cell apoptotic process, positive regulation of cAMP-mediated signaling, positive regulation of cell population proliferation, positive regulation of circadian sleep/wake cycle, non-REM sleep, positive regulation of cytosolic calcium ion concentration, positive regulation of growth hormone secretion, positive regulation of hormone secretion, positive regulation of multicellular organism growth, positive regulation of transcription, DNA-templated, response to dexamethasone, response to food, response to hypoxia, response to leptin |
| PubMed |
6406907
|
| Total Prosequence Length (aa) |
11 |
| Prosequence Location |
20:30 |
| Prosequence Sequence |
LPPSPPFRVRR |
| Preproprotein Sequence |
MPLWVFFVLLTLTSGSHCSLPPSPPFRVRRHADAIFTSSYRRILGQLYARKLLHEIMNRQQGERNQEQRSRFNRHLDRVWAEDKQMALESILQGFPRMKLSAEA |
