Details of PSQ01153
| ProSeqID |
PSQ01153 |
| Family |
FD00125 |
| Protein Name |
Brain-derived neurotrophic factor |
| UniProt ID |
P23560
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo |
| Organisms |
Homo sapiens (Human) |
| Prosequence Length (aa) |
110 |
| Functions |
growth factor activity, nerve growth factor receptor binding |
| Preproprotein Length (aa) |
247 |
| Alt Name |
Abrineurin |
| Gene Name |
BDNF |
| NCBI ID |
9606 |
| Cellular Localization |
axon, cytoplasm, dendrite, extracellular region, extracellular space, mitochondrion, nuclear speck, perinuclear region of cytoplasm, synaptic vesicle |
| Processes |
activation of phospholipase C activity, axon guidance, brain-derived neurotrophic factor receptor signaling pathway, collateral sprouting, memory, modulation of chemical synaptic transmission, negative regulation of apoptotic signaling pathway, negative regulation of myotube differentiation, negative regulation of neuron apoptotic process, nerve development, nerve growth factor signaling pathway, nervous system development, neuron projection morphogenesis, neurotrophin TRK receptor signaling pathway, peripheral nervous system development, positive regulation of brain-derived neurotrophic factor receptor signaling pathway, positive regulation of collateral sprouting, positive regulation of neuron projection development, positive regulation of non-membrane spanning protein tyrosine kinase activity, positive regulation of peptidyl-serine phosphorylation, positive regulation of receptor binding, positive regulation of synapse assembly, regulation of neuron differentiation, regulation of protein localization to cell surface, synapse assembly, transmembrane receptor protein tyrosine kinase signaling pathway |
| PubMed |
8527932
|
| Total Prosequence Length (aa) |
110 |
| Prosequence Location |
19:128 |
| Prosequence Sequence |
APMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRR |
| Preproprotein Sequence |
MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
