Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01152

ProSeqID PSQ01152
Family FD00358
Protein Name Photosystem I reaction center subunit PsaK
UniProt ID P23317
Taxonomy Bacteria-Cyanobacteria-Nostocales-Nostocaceae-Trichormus
Organisms Trichormus variabilis (strain ATCC 29413
Prosequence Length (aa) 8
Functions None
Preproprotein Length (aa) 86
Alt Name Light-harvesting 6, Photosystem I subunit X
Gene Name psaK
NCBI ID 240292
Cellular Localization integral component of membrane, photosystem I, plasma membrane-derived thylakoid membrane
Processes photosynthesis
PubMed 1908790
Total Prosequence Length (aa) 8
Prosequence Location 1:8
Prosequence Sequence MLTSTLLA
Preproprotein Sequence MLTSTLLAAATTPLEWSPTIGIIMVIANVIAITFGRQTIKYPSAEPALPSAKFFGGFGAPALLATTAFGHILGVGIILGLHNLGRF