Details of PSQ01185
| ProSeqID |
PSQ01185 |
| Family |
FD00016 |
| Protein Name |
Alpha-defensin 5 |
| UniProt ID |
P28312
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Mus-Mus |
| Organisms |
Mus musculus (Mouse) |
| Prosequence Length (aa) |
39 |
| Functions |
None |
| Preproprotein Length (aa) |
93 |
| Alt Name |
Defensin-related cryptdin-5 |
| Gene Name |
Defa5 |
| NCBI ID |
10090 |
| Cellular Localization |
extracellular space |
| Processes |
antibacterial humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, cellular response to lipopolysaccharide, defense response to bacterium, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, innate immune response in mucosa, membrane disruption in other organism |
| PubMed |
1500431
|
| Total Prosequence Length (aa) |
39 |
| Prosequence Location |
20:58 |
| Prosequence Sequence |
DPIHKTDEETNTEEQPGEEDQAVSISFGGQEGSALHEEL |
| Preproprotein Sequence |
MKTFVLLSALVLLAFQVQADPIHKTDEETNTEEQPGEEDQAVSISFGGQEGSALHEELSKKLICYCRIRGCKRRERVFGTCRNLFLTFVFCCS |