Details of PSQ01157
| ProSeqID |
PSQ01157 |
| Family |
FND00024 |
| Protein Name |
Dermaseptin-S1 |
| UniProt ID |
P24302
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Amphibia-Batrachia-Anura-Neobatrachia-Hyloidea-Hylidae-Phyllomedusinae-Phyllomedusa |
| Organisms |
Phyllomedusa sauvagei (Sauvage |
| Prosequence Length (aa) |
23 |
| Functions |
None |
| Preproprotein Length (aa) |
79 |
| Alt Name |
Dermaseptin , Dermaseptin I , Dermaseptin-1 |
| Gene Name |
None |
| NCBI ID |
8395 |
| Cellular Localization |
extracellular region |
| Processes |
defense response to bacterium, defense response to fungus, innate immune response, killing of cells of other organism, regulation of defense response to virus |
| PubMed |
1909573,
8306981
|
| Total Prosequence Length (aa) |
23 |
| Prosequence Location |
23:45 |
| Prosequence Sequence |
EEEKRENEDEEKQEDDEQSEMKR |
| Preproprotein Sequence |
MDILKKSLFLVLFLGLVSLSICEEEKRENEDEEKQEDDEQSEMKRALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ |