Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
Preproprotein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Download whole result Csv
Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions Preproprotein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ01951 FD00514 Acetylxylan esterase A Q8NJP6 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Eurotiales Trichocomaceae Talaromyces Talaromyces sect Talaromyces Talaromyces purpureogenus (Soft rot fungus) (Penicillium purpureogenum) 10 acetylxylan esterase activity, cellulose binding 382 AXE I, Acetylxylan esterase 1 axeA 1266744 extracellular region cellulose catabolic process, xylan catabolic process 17008082, 8756392 10 22:31 RTLGKDVNKR
PSQ01952 FD00070 Aorsin Q8NK92 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Eurotiales Aspergillaceae Aspergillus Aspergillus subgen Circumdati Aspergillus oryzae (strain ATCC 42149 193 metal ion binding, serine-type endopeptidase activity 659 None aorO 510516 extracellular region, extracellular space proteolysis 12519073 193 23:215 ATSVVHERREATSSNWVKRARVNPSDKHVVRIGLTQSSLEEAHDLLMDVSNPSSPNYARFYSADEVAAKFAPSTETVNEVQNWLTEKGINASRVAQTQNHGWLVFHATSKEIENLFDTTYYEYHNRKTGKKAIACEQYHVPASVQKHIDYVHPGVNLNPSSGKPSSIRRRAAASKKTKLPARGPRPIQQHDVK
PSQ01953 FD00002 Ranatuerin-2P Q8QFQ4 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Lithobates Lithobates pipiens (Northern leopard frog) (Rana pipiens) 24 None 71 None None 8404 extracellular region defense response to bacterium, defense response to fungus, killing of cells of other organism 10651828 24 21:44 LCEQERGADEDDGVEITEEEVKRG
PSQ01954 FD00004 Snake venom serine protease catroxase-2 Q8QHK2 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Crotalus Crotalus atrox (Western diamondback rattlesnake) 6 serine-type endopeptidase activity, toxin activity 258 Catroxase II, Kallikrein-like EI None 8730 extracellular region None 19371136, 6355088 6 19:24 QKSSEL
PSQ01955 FD00004 Snake venom serine protease catroxase-1 Q8QHK3 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Crotalus Crotalus atrox (Western diamondback rattlesnake) 6 serine-type endopeptidase activity, toxin activity 262 Catroxase I None 8730 extracellular region None 19371136 6 19:24 QKSSEP
PSQ01956 FD00050 Interleukin-36 gamma Q8R460 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 12 cytokine activity 164 Interleukin-1 family member 9 Il36g 10090 cytoplasm, extracellular space cellular response to lipopolysaccharide, cytokine-mediated signaling pathway, inflammatory response, inflammatory response to antigenic stimulus, innate immune response, negative regulation of myoblast differentiation, negative regulation of myoblast fusion, positive regulation of cytokine production, positive regulation of gene expression, positive regulation of interleukin-6 production 21965679 12 1:12 MFSKHPFSTHIS
PSQ01957 FND00264 Arabinogalactan protein 23 Q8S2W4 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 26 None 61 Arabinogalactan peptide 23 AGP23 3702 anchored component of membrane, plasma membrane None 15322080 26 36:61 AASAALPALGSLVGASLVSLFSYYLH
PSQ01958 FND00240 Neuropeptide CCHamide-2 Q8SXL2 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 94 neuropeptide hormone activity 136 None CCHa2 7227 extracellular space neuropeptide signaling pathway 21214272, 23293632 94 43:136 SLSPGSGSGTGVGGGMGEAASGGQEPDYVRPNGLLPMMAPNEQVPLEGDFNDYPARQVLYKIMKSWFNRPRRPASRLGELDYPLANSAELNGVN
PSQ01959 FND00126 Lysozyme A Q8T1G4 Eukaryota Amoebozoa Evosea Eumycetozoa Dictyostelia Dictyosteliales Dictyosteliaceae Dictyostelium Dictyostelium discoideum (Slime mold) 43 lysozyme activity 181 1 alyA 44689 cytoplasmic vesicle, cytoplasmic vesicle lumen, vesicle lumen cytolysis, defense response to Gram-positive bacterium, peptidoglycan catabolic process, phagocytosis 15640146 43 139:181 LTDSRPLGPFNVTESEMAQLFIDHEIAMAQCEAEKTCNGFDLE
PSQ01960 FD00171 Moronecidin Q8UUG0 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Actinopterygii Neopterygii Teleostei Neoteleostei Acanthomorphata Eupercaria Moronidae Morone Morone saxatilis (Striped bass) (Perca saxatilis) 33 None 79 Piscidin-1 None 34816 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11713517 33 47:79 AEQDQQDQQYQQEQQEQQAQQYQRFNRERAAFD
PSQ01961 FD00013 Zinc metalloproteinase-disintegrin-like berythractivase Q8UVG0 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Bothrops Bothrops erythromelas (Caatinga lance head) 167 metal ion binding, metalloendopeptidase activity, peptidase activator activity, toxin activity 612 Snake venom metalloproteinase, ery1 None 44710 extracellular region None 12225292 167 21:187 IILESGNVNDYEVVYPRKVTALSKGAVHPKYEDAMQYEFKVNGEPVVLHLEKNKGLFSEDYSEIHYSPDGREITTYPLVEDHCYYHGRIQNDADSSASISACNGLKGHFKLQGEMYLIEPFKLPDSEAHAVFKYENVEKEDEAPKMCGVTETNWESDEPIKKASLLN
PSQ01962 FD00221 Bowman-Birk type proteinase inhibitor Q8W4Y8 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade Hologalegina IRL clade Fabeae Lens Lens culinaris (Lentil) (Cicer lens) 14 serine-type endopeptidase inhibitor activity 110 LCTI, Trypsin None 3864 extracellular region None 15212472, 16889634 14 29:42 RFDSTSFITQVLSN
PSQ01963 FD00496 Cardioactive peptide Q8WRC7 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Lepidoptera Glossata Ditrysia Bombycoidea Sphingidae Sphinginae Sphingini Manduca Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) 20, 69 neuropeptide hormone activity 125 Cardioacceleratory peptide 2a, Crustacean cardioactive peptide CCAP 7130 extracellular region neuropeptide signaling pathway, positive regulation of heart contraction 1426284;1426284 89 23:42, 57:125 ASIPRNFDPRLSEEIVMAPK, RSQGPPGMPAQDLRTKQYLDEEALGSILDSESAIDELSRQILSEAKLWEAIQEASAEIARRKQKEAYIQ
PSQ01964 FD00211 Attacin-A Q8WTD3 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Hippoboscoidea Glossinidae Glossina Glossina morsitans morsitans (Savannah tsetse fly) 27 None 208 None None 37546 extracellular region antibacterial humoral response, defense response to Gram-negative bacterium, innate immune response 11886771 27 21:47 QFGGTVSSNPNGGLDVNARLSKTIGDP
PSQ01965 FND00166 Defensin-A Q8WTD4 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Hippoboscoidea Glossinidae Glossina Glossina morsitans morsitans (Savannah tsetse fly) 25 None 87 None None 37546 extracellular region antibacterial humoral response, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, innate immune response 11886771 25 20:44 LPAGDETRIDLETLEEDLRLVDGAQ
PSQ01966 FD00592 Internalin J Q8Y3L4 Bacteria Firmicutes Bacilli Bacillales Listeriaceae Listeria Listeria monocytogenes serovar 1 27 None 851 None inlJ 169963 cell wall, extracellular region cell adhesion, pathogenesis 18227172 27 825:851 GDSAPWKSALLGVFLSSTALVIWKKKK
PSQ01967 FD00341 Cell wall protein Lmo2714 Q8Y3W5 Bacteria Firmicutes Bacilli Bacillales Listeriaceae Listeria Listeria monocytogenes serovar 1 29 None 315 Wall-associated protein lmo2714 None 169963 cell wall, extracellular region None 11929538, 16247833 29 287:315 GDKGTEWIFVVAGVIVILVAVLLLRKRKK
PSQ01968 FD00571 Hemin Q8Y585 Bacteria Firmicutes Bacilli Bacillales Listeriaceae Listeria Listeria monocytogenes serovar 1 30 hemoglobin binding 207 Cell wall protein Lmo2186 hbp1 169963 extracellular region, peptidoglycan-based cell wall cellular response to iron ion, heme transport, iron ion homeostasis 16247833 30 178:207 SDSSQMFLYGIIFVATGAGLILLKRRAIFK
PSQ01969 FD00233 Cell wall protein Lmo0880 Q8Y8L7 Bacteria Firmicutes Bacilli Bacillales Listeriaceae Listeria Listeria monocytogenes serovar 1 26 collagen binding, lytic endotransglycosylase activity 462 None None 169963 cell wall, extracellular region cell adhesion 11929538, 16247833, 22837151 26 437:462 GDSNPFIPFVTGLSLIALGFTFGRKS
PSQ01970 FD00347 Cell wall protein Lmo0130 Q8YAJ5 Bacteria Firmicutes Bacilli Bacillales Listeriaceae Listeria Listeria monocytogenes serovar 1 26 5, metal ion binding, nucleotide binding, UDP-sugar diphosphatase activity 784 None None 169963 cell wall, extracellular region, outer membrane-bounded periplasmic space nucleotide catabolic process 11929538, 16247833, 22837151 26 759:784 GDTAGLATVFGVILTTTALYVLRKRS
PSQ01971 FD00013 Zinc metalloproteinase-disintegrin-like ecarin Q90495 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Viperinae Echis Echis carinatus (Saw-scaled viper) 170 metal ion binding, metalloendopeptidase activity, peptidase activator activity, toxin activity 616 Snake venom metalloproteinase None 40353 extracellular region None 7849037 170 21:190 IILGSGNVNDYEVVYPQKVTALPKGAVQQPEQKYEDAMQYEFEVKGEPVVLHLEKNKELFSEDYSETHYSSDDREITTNPSVEDHCYYHGRIQNDAESTASISACNGLKGHFKLRGETYFIEPLKIPDSEAHAVYKYENIENEDEAPKMCGVTQDNWESDEPIKKTLGLI
PSQ01972 FD00569 72 kDa type IV collagenase Q90611 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Galliformes Phasianidae Phasianinae Gallus Gallus gallus (Chicken) 80 metalloendopeptidase activity, zinc ion binding 663 72 kDa gelatinase, Gelatinase A, Matrix metalloproteinase-2 MMP2 9031 basement membrane, collagen-containing extracellular matrix, extracellular space, plasma membrane, sarcomere blood vessel maturation, bone trabecula formation, cellular response to amino acid stimulus, cellular response to insulin-like growth factor stimulus, cellular response to reactive oxygen species, cellular response to UV-A, collagen catabolic process, endodermal cell differentiation, extracellular matrix organization, face morphogenesis, intramembranous ossification, negative regulation of cartilage condensation, negative regulation of cartilage development, negative regulation of focal adhesion assembly, negative regulation of protein phosphorylation, positive regulation of vascular associated smooth muscle cell proliferation, regulation of MAPK cascade, response to amyloid-beta, response to hypoxia, tissue remodeling 1848240 80 27:106 APSPIIKFPGDSTPKTDKELAVQYLNKYYGCPKDNCNLFVLKDTLKKMQKFFGLPETGDLDQNTIETMKKPRCGNPDVAN
PSQ01973 FD00010 Basic phospholipase A2 2 Q90WA8 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Elapidae Bungarinae Bungarus Bungarus fasciatus (Banded krait) (Pseudoboa fasciata) 8 calcium ion binding, phospholipase A2 activity, phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine), phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine), toxin activity 145 KBf II , KBf-2, Phosphatidylcholine 2-acylhydrolase, Phospholipase A2 isozyme II None 8613 extracellular region arachidonic acid secretion, lipid catabolic process, phospholipid metabolic process 17166178 8 20:27 ANIPPQSL
PSQ01974 FD00329 Ovochymase-2 Q90WD8 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Bufonidae Bufo Bufo japonicus (Japanese toad) 28 metal ion binding, serine-type endopeptidase activity 974 Oviductal protease, Oviductin OVCH2 8387 extracellular region None 11846486 28 22:49 VTDSPGRVSRCGERPAANTSVSYGLLSR
PSQ01975 FD00015 Zinc metalloproteinase Q90YA6 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Protobothrops Protobothrops elegans (Elegant pitviper) (Trimeresurus elegans) 16 metal ion binding, metalloendopeptidase activity, toxin activity 481 None None 88086 extracellular region None 8920980 16 393:408 LRTDTVSTPVSGNEFL
PSQ01976 FD00013 Zinc metalloproteinase-disintegrin-like HV1 Q90ZI3 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Protobothrops Protobothrops flavoviridis (Habu) (Trimeresurus flavoviridis) 168 metal ion binding, metalloendopeptidase activity, peptidase activator activity, toxin activity 612 Snake venom metalloproteinase, Vascular apoptosis-inducing protein None 88087 extracellular region apoptotic process 11389737 168 21:188 IILESGNVNDYEVVYPRKVTALPKGAVQQKYEDAMQYEFTVNGEPVVLHLEKNKGLFSEDYSETHYSPDGREITTNPPVEDHCYYHGRIQNDADLTASISACDGLKGHFKLQGETYIIEPLKLPDSEAHAVFKYENVEKEDEAPKMCGVTQSNWESDESIKEDSQSNL
PSQ01977 FND00315 PYLa/PGLa B Q91826 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Pipoidea Pipidae Xenopodinae Xenopus Xenopus Xenopus laevis (African clawed frog) 15 None 64 None pgla-b 8355 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 6688991 15 21:35 EASALADADDDDDKR
PSQ01978 FD00058 Snake venom metalloproteinase ACLH Q92032 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Agkistrodon Agkistrodon contortrix laticinctus (Broad-banded copperhead) (Agkistrodon, mokasen laticinctus) 167 metal ion binding, metalloendopeptidase activity, toxin activity 407 ACL hemorrhagic toxin I, Hemorrhagic metalloproteinase ACLH None 37195 extracellular region None 8444323 167 21:187 IILESGNVNDYEVVYPRKVTPVPKGAVQPKYEDAMQYELKVNGEPVVLHLERNKGLFSKDYSETHYSPDGRKITTYPPVEDHCYYHGRIQNDADSIASISACNGLKGHFKLQGEMYLIEPLELSDSEAHAVFKYENVEKEDEAPKICGVTQNWESYEPIKKASQLNL
PSQ01979 FD00010 Neutral phospholipase A2 muscarinic inhibitor Q92084 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Elapidae Elapinae Naja Naja sputatrix (Malayan spitting cobra) (Naja naja sputatrix) 6 calcium ion binding, phospholipase A2 activity, phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine), phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine), toxin activity 146 NAJPLA-2A, Phosphatidylcholine 2-acylhydrolase, Phospholipase A2 A None 33626 extracellular region arachidonic acid secretion, lipid catabolic process, phospholipid metabolic process 8638927, 9028006 6 22:27 NRPMPL
PSQ01980 FD00212 Catalase B Q92405 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Eurotiales Aspergillaceae Aspergillus Aspergillus subgen Fumigati Neosartorya fumigata (strain ATCC MYA-4609 , A1100) (Aspergillus fumigatus) 12 catalase activity, heme binding, metal ion binding 728 Antigenic catalase, Slow catalase catB 330879 cell surface, cytosol, extracellular region cellular response to hydrogen peroxide, cellular response to iron ion starvation, hydrogen peroxide catabolic process, response to oxidative stress 9353056 12 16:27 VCPYMTGELNRR
PSQ01981 FD00225 Sortilin-related receptor Q92673 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 53 amyloid-beta binding, low-density lipoprotein particle binding, low-density lipoprotein particle receptor activity, neuropeptide binding, small GTPase binding, transmembrane signaling receptor activity 2220 Low-density lipoprotein receptor relative with 11 ligand-binding repeats, SorLA-1 , Sorting protein-related receptor containing LDLR class A repeats SORL1 9606 cell surface, early endosome, early endosome membrane, endoplasmic reticulum, endoplasmic reticulum membrane, endosome, endosome membrane, extracellular exosome, extracellular space, Golgi apparatus, Golgi cisterna, Golgi membrane, integral component of membrane, integral component of plasma membrane, membrane, multivesicular body, multivesicular body membrane, nuclear envelope lumen, perinucleolar compartment, plasma membrane, recycling endosome, recycling endosome membrane, trans-Golgi network, transport vesicle membrane adaptive thermogenesis, amyloid fibril formation, diet induced thermogenesis, insulin receptor recycling, negative regulation of amyloid-beta formation, negative regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process, negative regulation of BMP signaling pathway, negative regulation of MAP kinase activity, negative regulation of metalloendopeptidase activity involved in amyloid precursor protein catabolic process, negative regulation of neurofibrillary tangle assembly, negative regulation of neurogenesis, negative regulation of neuron death, negative regulation of protein binding, negative regulation of protein-containing complex assembly, negative regulation of tau-protein kinase activity, negative regulation of triglyceride catabolic process, neuropeptide signaling pathway, positive regulation of adipose tissue development, positive regulation of choline O-acetyltransferase activity, positive regulation of early endosome to recycling endosome transport, positive regulation of endocytic recycling, positive regulation of ER to Golgi vesicle-mediated transport, positive regulation of glial cell-derived neurotrophic factor production, positive regulation of insulin receptor signaling pathway, positive regulation of protein catabolic process, positive regulation of protein exit from endoplasmic reticulum, positive regulation of protein localization to early endosome, post-Golgi vesicle-mediated transport, protein localization to Golgi apparatus, protein maturation, protein retention in Golgi apparatus, protein targeting, protein targeting to lysosome, receptor-mediated endocytosis, regulation of smooth muscle cell migration 8940146 53 29:81 EVWTQRLHGGSAPLPQDRGFLVVQGDPRELRLWARGDARGASRADEKPLRRKR
PSQ01982 FD00498 Fervidolysin Q93LQ6 Bacteria Thermotogae Thermotogales Fervidobacteriaceae Fervidobacterium Fervidobacterium pennivorans 128 calcium ion binding, peptidase activity, serine-type endopeptidase activity 699 Keratinase , Subtilisin-like serine protease fls 93466 cell surface protein autoprocessing, proteolysis 12072953 128 22:149 NPSFEPRSKAKDLASLPEIKSQGYHILFGELRDGEYTEGKILVGYNDRSEVDKIVKAVNGKVVLELPQIKVVSIKLNGMTVKQAYDKIKALALKGIRYVEPSYKRELIKPTVVKPNPDMYKIRKPGLN
PSQ01983 FND00048 Hydroxyproline-rich systemin B Q93WP7 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Nicotianoideae Nicotianeae Nicotiana Nicotiana tabacum (Common tobacco) 17, 89 hormone activity 164 None None 4097 extracellular region defense response 11459063;11459063 106 19:35, 54:142 RTLLENHEGLNVGSGYG, VSNSVSPTRTDEKTSENTELVMTTIAQGENSNQLFPFLTSSDNYQLASFKKLSISYLLPVSYVWKLISSSSFNHDLVDIFDTSSDEKYW
PSQ01984 FND00048 Hydroxyproline-rich systemin A Q93WP8 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Nicotianoideae Nicotianeae Nicotiana Nicotiana tabacum (Common tobacco) 17, 90 hormone activity 165 None None 4097 extracellular region defense response 11459063;11459063 107 19:35, 54:143 RTLLENHEGLNVGSGYG, VSNSVSPTRTDEKTSENTELVMTTIAQGENINQLFSFPTSADNYYQLASFKKLFISYLLPVSYVWNLIGSSSFDHDLVDIFDSKSDERYW
PSQ01985 FD00385 Snakin-2 Q93X17 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Solanoideae Solaneae Solanum Solanum tuberosum (Potato) 15 None 104 None SN2 4113 cell wall, extracellular region defense response 11891250 15 24:38 IQTDQVTSNAISEAA
PSQ01986 FD00381 Stachyose synthase Q93XK2 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade Hologalegina IRL clade Fabeae Pisum Pisum sativum (Garden pea) 11 galactinol-raffinose galactosyltransferase activity 853 Galactinol--raffinose galactosyltransferase STS1 3888 cytoplasm oligosaccharide biosynthetic process, stachyose biosynthetic process 11675396 11 1:11 MAPPLNSTTSN
PSQ01987 FD00366 Rapid alkalinization factor Q945T0 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Nicotianoideae Nicotianeae Nicotiana Nicotiana tabacum (Common tobacco) 43 hormone activity, receptor ligand activity 120 None RALF 4097 extracellular region, plasmodesma calcium-mediated signaling, regulation of signaling receptor activity 11675511 43 24:66 GDSGAYDWVMPARSGGGCKGSIGECIAEEEEFELDSESNRRIL
PSQ01988 FD00180 Cathepsin L 1 Q94714 Eukaryota Sar Alveolata Ciliophora Intramacronucleata Oligohymenophorea Peniculida Parameciidae Paramecium Paramecium tetraurelia 85 cysteine-type endopeptidase activity 314 None None 5888 extracellular space, lysosome proteolysis involved in cellular protein catabolic process 8665938 85 25:109 LYANWKMKYNRRYTNQRDEMYRYKVFTDNLNYIRAFYESPEEATFTLELNQFADMSQQEFAQTYLSLKVPRTAKLNAANSNFQYK
PSQ01989 FD00082 Cathepsin B-like protease 3 Q94K85 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 76, 17 cysteine-type endopeptidase activity 360 Cathepsin B3 CATHB3 3702 cytosol, extracellular space, lysosome, secretory vesicle, vacuole defense response, proteolysis involved in cellular protein catabolic process, regulation of catalytic activity 27058316;27058316 93 27:102, 343:359 GIEAESLTKQKLDSKILQDEIVKKVNENPNAGWKAAINDRFSNATVAEFKRLLGVKPTPKKHFLGVPIVSHDPSLK, NVFRVDTGSNDLPVASV
PSQ01990 FND00313 Basic proline-rich protein Q95JC9 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Suina Suidae Sus Sus scrofa (Pig) 49 hormone activity 676 None None 9823 extracellular region None 16112392 49 409:457 APPGARPPPPPPPPADEPQQGPAPSGDKPKKKPPPPAGPPPPGPPSPGP
PSQ01991 FD00107 Legumain Q95M12 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos Bos taurus (Bovine) 8 cysteine-type endopeptidase activity 433 Asparaginyl endopeptidase, Protease LGMN 9913 lysosome negative regulation of ERBB signaling pathway, proteolysis, proteolysis involved in cellular protein catabolic process, receptor catabolic process, renal system process 11983426 8 18:25 VPLEDPED
PSQ01992 FD00098 PBAN-type neuropeptides Q95P48 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Lepidoptera Glossata Ditrysia Noctuoidea Noctuidae Amphipyrinae Spodoptera Spodoptera littoralis (Egyptian cotton leafworm) 44, 23 neuropeptide hormone activity 191 None None 7109 extracellular region neuropeptide signaling pathway, pheromone biosynthetic process 28502715;28502715 67 48:91, 169:191 SLRISTEDNRQAFFKLLEAADALKYYYDRLPYEMQADEPETRVT, ELSYDMLPSKLRLVRSTNRTQST
PSQ01993 FD00015 Zinc metalloproteinase Q98SP2 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Bothrops Bothrops jararaca (Jararaca) (Bothrops jajaraca) 167 metal ion binding, metalloendopeptidase activity, toxin activity 480 None None 8724 extracellular region None 1523677 167 21:187 IILESGNVNDYEVIYPRKVTALPKGAVQPKYEDAMQYELKVNGEPVVLHLEKNKGLFSKDYSETHYSPDGRKITTNPPVEDHCYYHGRIENDADSTASISACNGLKGHFKLQGETYLIEPLKLSDSEAHAVFKFENVEKEDEAPKMCGVTQNWESYEPIKKASQSNL
PSQ01994 FND00346 Ice-structuring protein B Q99013 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Actinopterygii Neopterygii Teleostei Neoteleostei Acanthomorphata Carangaria Pleuronectiformes Pleuronectoidei Pleuronectidae Pseudopleuronectes Pseudopleuronectes americanus (Winter flounder) (Pleuronectes americanus) 21 ice binding 82 Antifreeze protein B, HPLC8 None 8265 extracellular space homoiothermy, response to freezing 3769927 21 24:44 RPDPAAKAAPAAAAVPAAAAP
PSQ01995 FD00516 Pesticidal crystal protein Cry9Aa Q99031 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus cereus group Bacillus thuringiensis subsp 23 signaling receptor binding, toxin activity 1156 130 kDa crystal protein, Crystaline entomocidal protoxin, Insecticidal delta-endotoxin CryIXA(a) cry9Aa 29338 None pathogenesis, sporulation resulting in formation of a cellular spore 1660003 23 1:23 MNQNKHGIIGASNCGCASDDVAK
PSQ01996 FD00312 Mannan endo-1 Q99036 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Sordariomycetes Hypocreomycetidae Hypocreales Hypocreaceae Trichoderma Hypocrea jecorina (strain ATCC 56765 , (Trichoderma reesei) 8 cellulose binding, disaccharide binding, mannan endo-1,4-beta-mannosidase activity 437 Beta-mannanase 5A, Beta-mannanase I, Endo-beta-1 man1 1344414 extracellular region mannan catabolic process 7793911 8 20:27 AVLQPVPR
PSQ01997 FD00203 Proheparin-binding EGF-like growth factor Q99075 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 43 epidermal growth factor receptor binding, growth factor activity, heparin binding 208 None HBEGF 9606 cell surface, clathrin-coated endocytic vesicle membrane, endocytic vesicle membrane, extracellular region, extracellular space, integral component of plasma membrane, plasma membrane cell chemotaxis, epidermal growth factor receptor signaling pathway, ERBB2 signaling pathway, MAPK cascade, membrane organization, muscle organ development, negative regulation of elastin biosynthetic process, negative regulation of epidermal growth factor receptor signaling pathway, positive regulation of cell growth, positive regulation of cell migration, positive regulation of cell population proliferation, positive regulation of epidermal growth factor-activated receptor activity, positive regulation of keratinocyte migration, positive regulation of protein kinase B signaling, positive regulation of smooth muscle cell proliferation, positive regulation of wound healing, regulation of cell motility, regulation of heart contraction, signal transduction, wound healing, spreading of epidermal cells 1556128 43 20:62 LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVR
PSQ01998 FD00053 M-protease Q99405 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Alkalihalobacillus Bacillus clausii (strain KSM-K16) 84 metal ion binding, serine-type endopeptidase activity 380 None aprE 66692 extracellular region None 7632397 84 28:111 AEEAKEKYLIGFNEQEAVSEFVEQIEANDDVAILSEEEEVEIELLHEFETIPVLSVELSPEDVDALELDPTISYIEEDAEVTTM
PSQ01999 FD00124 Sortilin Q99523 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 44 enzyme binding, nerve growth factor binding, nerve growth factor receptor activity, neurotensin receptor activity, non-G protein-coupled, retromer complex binding 838 100 kDa NT receptor, Glycoprotein 95, Neurotensin receptor 3 SORT1 9606 cell surface, clathrin-coated pit, clathrin-coated vesicle, cytoplasmic vesicle, cytoplasmic vesicle membrane, cytosol, dendrite, early endosome, endoplasmic reticulum membrane, endosome membrane, Golgi apparatus, Golgi cisterna membrane, integral component of membrane, lysosomal membrane, lysosome, neuronal cell body, nuclear membrane, perinuclear region of cytoplasm, plasma membrane, trans-Golgi network transport vesicle endocytosis, endosome to lysosome transport, endosome transport via multivesicular body sorting pathway, extrinsic apoptotic signaling pathway via death domain receptors, G protein-coupled receptor signaling pathway, glucose import, Golgi to endosome transport, Golgi to lysosome transport, multicellular organism development, myotube differentiation, negative regulation of fat cell differentiation, negative regulation of lipoprotein lipase activity, neuropeptide signaling pathway, neurotrophin TRK receptor signaling pathway, ossification, plasma membrane to endosome transport, positive regulation of epithelial cell apoptotic process, post-Golgi vesicle-mediated transport, protein targeting to lysosome, regulation of gene expression, response to insulin, vesicle organization 9756851 44 34:77 QDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRR
PSQ02000 FD00219 Matrix metalloproteinase-19 Q99542 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 79 metalloendopeptidase activity, zinc ion binding 508 Matrix metalloproteinase RASI, Matrix metalloproteinase-18 MMP19 9606 extracellular matrix, extracellular region, extracellular space angiogenesis, cell differentiation, collagen catabolic process, extracellular matrix disassembly, extracellular matrix organization, luteolysis, ovarian follicle development, ovulation from ovarian follicle, proteolysis, response to cAMP, response to hormone 10809722 79 19:97 RVLGLAEVAPVDYLSQYGYLQKPLEGSNNFKPEDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLK
Total Pages 43
Go to Lab Web Page