Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
Preproprotein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Download whole result Csv
Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions Preproprotein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ02001 FD00195 Forkhead box protein P3 Q99JB6 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 12 DNA binding, DNA-binding transcription factor activity, DNA-binding transcription factor activity, RNA polymerase II-specific, DNA-binding transcription repressor activity, RNA polymerase II-specific, histone acetyltransferase binding, histone deacetylase binding, identical protein binding, metal ion binding, NFAT protein binding, protein homodimerization activity, RNA polymerase II cis-regulatory region sequence-specific DNA binding, sequence-specific DNA binding, sequence-specific double-stranded DNA binding, transcription corepressor activity 429 Scurfin Foxp3 10090 cytoplasm, nucleoplasm, nucleus B cell homeostasis, CD4-positive, CD25-positive, alpha-beta regulatory T cell lineage commitment, gene expression, myeloid cell homeostasis, negative regulation of cell population proliferation, negative regulation of chronic inflammatory response, negative regulation of CREB transcription factor activity, negative regulation of cytokine production, negative regulation of defense response to virus, negative regulation of DNA-binding transcription factor activity, negative regulation of gene expression, negative regulation of histone acetylation, negative regulation of histone deacetylation, negative regulation of immune response, negative regulation of inflammatory response, negative regulation of interferon-gamma production, negative regulation of interleukin-10 production, negative regulation of interleukin-17 production, negative regulation of interleukin-2 production, negative regulation of interleukin-4 production, negative regulation of interleukin-5 production, negative regulation of interleukin-6 production, negative regulation of isotype switching to IgE isotypes, negative regulation of lymphocyte proliferation, negative regulation of NF-kappaB transcription factor activity, negative regulation of T cell cytokine production, negative regulation of T cell proliferation, negative regulation of T-helper 17 cell differentiation, negative regulation of transcription by RNA polymerase II, negative regulation of transcription, DNA-templated, negative regulation of tumor necrosis factor production, positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation, positive regulation of gene expression, positive regulation of histone acetylation, positive regulation of immature T cell proliferation in thymus, positive regulation of interleukin-4 production, positive regulation of peripheral T cell tolerance induction, positive regulation of regulatory T cell differentiation, positive regulation of T cell anergy, positive regulation of T cell tolerance induction, positive regulation of transcription by RNA polymerase II, positive regulation of transcription, DNA-templated, positive regulation of transforming growth factor beta1 production, regulation of immunoglobulin production, regulation of isotype switching to IgG isotypes, regulation of T cell anergy, regulation of transcription by RNA polymerase II, response to lipopolysaccharide, response to virus, T cell activation, T cell mediated immunity, T cell receptor signaling pathway, tolerance induction, tolerance induction to self antigen 19117830 12 418:429 SQRPNKCSNPCP
PSQ02002 FD00130 Augurin Q99LS0 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 39 neuropeptide hormone activity 148 Esophageal cancer-related gene 4 protein homolog Ecrg4 10090 apical plasma membrane, cytoplasm, dense core granule, extracellular space anaphase-promoting complex-dependent catabolic process, cellular senescence, central nervous system development, G1 to G0 transition, negative regulation of cell population proliferation, neuropeptide signaling pathway, positive regulation of corticosterone secretion, positive regulation of corticotropin secretion, positive regulation of corticotropin-releasing hormone secretion, regulation of cell population proliferation, response to wounding, vasopressin secretion 17284679 39 32:70 NKLKKMLQKREGPVPSKTNVAVAENTAKEFLGGLKRAKR
PSQ02003 FD00052 Urocortin-2 Q99ML8 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 48 corticotropin-releasing hormone receptor 2 binding, corticotropin-releasing hormone receptor binding, G protein-coupled receptor binding, hormone activity, hormone binding 120 Urocortin II Ucn2 10090 extracellular space adenylate cyclase-activating G protein-coupled receptor signaling pathway, cell population proliferation, cellular response to nutrient levels, digestion, hormone-mediated signaling pathway, negative regulation of follicle-stimulating hormone secretion, negative regulation of gene expression, negative regulation of luteinizing hormone secretion 23493376 48 24:71 TPIPTFQLLPQNSLETTPSSVTSESSSGTTTGPSASWSNSKASPYLDT
PSQ02004 FD00310 Lectin-B Q9AVB0 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae Caryophyllales Phytolaccaceae Phytolacca Phytolacca americana (American pokeweed) (Phytolacca decandra) 15, 25 carbohydrate binding, chitin binding 361 PL-B None 3527 None positive regulation of cell division, positive regulation of mitotic nuclear division 9145528;9145528 40 27:41, 337:361 HEGHGVVELIMGKLG, SLPSPLSQILAIRKLNATIPTMAVE
PSQ02005 FD00318 Lectin-C Q9AYP9 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae Caryophyllales Phytolaccaceae Phytolacca Phytolacca americana (American pokeweed) (Phytolacca decandra) 18, 24 carbohydrate binding, chitin binding 194 PL-C None 3527 None positive regulation of cell division, positive regulation of mitotic nuclear division 7670205;7670205 42 27:44, 171:194 QGHEGHGVGEILLMGKLG, LLPSPLRRIIAIRKLKANLANMLS
PSQ02006 FD00003 Conotoxin elongated-tx3a-a Q9BH73 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Cylinder Conus textile (Cloth-of-gold cone) 20 ion channel inhibitor activity, toxin activity 70 None None 6494 extracellular region pathogenesis 22709442 20 25:44 DQPVERYAENKQLLSPDERR
PSQ02007 FD00177 Omega-hexatoxin-Hi2a Q9BJV9 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Hexathelidae Hadronyche Hadronyche infensa (Fraser island funnel-web spider) (Atrax infensus) 33 sodium channel inhibitor activity, toxin activity 102 Omega-atracotoxin-Hi2a None 153481 extracellular region pathogenesis 11522785 33 24:56 KINEDFMENGLESHALHDEIRKPIDTEKADAER
PSQ02008 FD00003 TxMLKM-021 Q9BPI0 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Cylinder Conus textile (Cloth-of-gold cone) 30 ion channel inhibitor activity, toxin activity 71 Conotoxin 2 None 6494 extracellular region pathogenesis 19380747 30 25:54 DQPVERYAENKQLLNTDERREIILSALRTR
PSQ02009 FD00003 TxMMSK-03 Q9BPJ7 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Cylinder Conus textile (Cloth-of-gold cone) 31 ion channel inhibitor activity, toxin activity 68 Conotoxin 3 None 6494 extracellular region pathogenesis 23031820 31 20:50 VPMDGDQPADRPAERMQDDISFEQHPMFDAT
PSQ02010 FD00351 UL16-binding protein 2 Q9BZM5 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 30 natural killer cell lectin-like receptor binding 246 ALCAN-alpha, NKG2D ligand 2, Retinoic acid early transcript 1H ULBP2 9606 anchored component of plasma membrane, cell surface, endoplasmic reticulum, external side of plasma membrane, extracellular region, extracellular space, plasma membrane natural killer cell activation, natural killer cell mediated cytotoxicity, viral process 11444831 30 217:246 SGTTQLRATATTLILCCLLIILPCFILPGI
PSQ02011 FD00195 Forkhead box protein P3 Q9BZS1 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 14 DNA binding, DNA-binding transcription factor activity, DNA-binding transcription factor activity, RNA polymerase II-specific, DNA-binding transcription repressor activity, RNA polymerase II-specific, histone acetyltransferase binding, histone deacetylase binding, metal ion binding, NF-kappaB binding, NFAT protein binding, protein homodimerization activity, RNA polymerase II cis-regulatory region sequence-specific DNA binding, sequence-specific DNA binding, sequence-specific double-stranded DNA binding, transcription corepressor activity 431 Scurfin FOXP3 9606 chromatin, cytoplasm, nucleoplasm, nucleus, protein-containing complex B cell homeostasis, CD4-positive, CD25-positive, alpha-beta regulatory T cell lineage commitment, chromatin remodeling, gene expression, myeloid cell homeostasis, negative regulation of activated T cell proliferation, negative regulation of cell population proliferation, negative regulation of chronic inflammatory response, negative regulation of CREB transcription factor activity, negative regulation of cytokine production, negative regulation of DNA-binding transcription factor activity, negative regulation of histone acetylation, negative regulation of histone deacetylation, negative regulation of immune response, negative regulation of interferon-gamma production, negative regulation of interleukin-10 production, negative regulation of interleukin-17 production, negative regulation of interleukin-2 production, negative regulation of interleukin-4 production, negative regulation of interleukin-5 production, negative regulation of interleukin-6 production, negative regulation of isotype switching to IgE isotypes, negative regulation of NF-kappaB transcription factor activity, negative regulation of T cell cytokine production, negative regulation of T cell proliferation, negative regulation of T-helper 17 cell differentiation, negative regulation of transcription by RNA polymerase II, negative regulation of transcription, DNA-templated, negative regulation of tumor necrosis factor production, positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation, positive regulation of histone acetylation, positive regulation of immature T cell proliferation in thymus, positive regulation of interleukin-4 production, positive regulation of peripheral T cell tolerance induction, positive regulation of T cell anergy, positive regulation of transcription by RNA polymerase II, positive regulation of transcription, DNA-templated, positive regulation of transforming growth factor beta1 production, regulation of isotype switching to IgG isotypes, regulation of regulatory T cell differentiation, regulation of T cell anergy, regulation of transcription by RNA polymerase II, regulation of transcription, DNA-templated, regulation of Wnt signaling pathway, response to lipopolysaccharide, response to virus, T cell activation, T cell homeostasis, T cell mediated immunity, T cell receptor signaling pathway, tolerance induction to self antigen 19117830 14 418:431 SQRPSRCSNPTPGP
PSQ02012 FD00212 Catalase-3 Q9C169 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Sordariomycetes Sordariomycetidae Sordariales Sordariaceae Neurospora Neurospora crassa (strain ATCC 24698 , FGSC 987) 12 catalase activity, heme binding, metal ion binding 720 None cat-3 367110 cytosol hydrogen peroxide catabolic process, response to oxidative stress 12160934 12 19:30 ACPFADPSALGR
PSQ02013 FND00047 Arabinogalactan protein 21 Q9C8A4 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 22 None 60 Arabinogalactan peptide 21 AGP21 3702 anchored component of membrane, plasma membrane None 15322080 22 37:58 DAAMFVPALFASVVALASGFIF
PSQ02014 FD00054 Endonuclease 2 Q9C9G4 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 8 double-stranded DNA exodeoxyribonuclease activity, endonuclease activity, endoribonuclease activity, metal ion binding, nucleic acid binding, single-stranded DNA endodeoxyribonuclease activity, T/G mismatch-specific endonuclease activity 290 Deoxyribonuclease ENDO2 , Single-stranded-nucleate endonuclease ENDO2 ENDO2 3702 None DNA catabolic process, RNA phosphodiester bond hydrolysis, endonucleolytic 23620482 8 283:290 ATLNRIFG
PSQ02015 FD00050 Interleukin-36 beta Q9D6Z6 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 30 cytokine activity, interleukin-1 receptor binding 183 Interleukin-1 family member 8 Il36b 10090 cytoplasm, extracellular space cellular response to lipopolysaccharide, cytokine-mediated signaling pathway, inflammatory response, inflammatory response to antigenic stimulus, innate immune response, positive regulation of cytokine production, positive regulation of gene expression, positive regulation of interleukin-6 production, positive regulation of T cell differentiation 21965679 30 1:30 MMAFPPQSCVHVLPPKSIQMWEPNHNTMHG
PSQ02016 FD00324 Metalloendopeptidase OMA1 Q9D8H7 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 60 lipid binding, metal ion binding, metalloendopeptidase activity 521 Overlapping with the m-AAA protease 1 homolog Oma1 10090 integral component of membrane, mitochondrial inner membrane, mitochondrial membrane, mitochondrion cristae formation, diet induced thermogenesis, energy homeostasis, glucose metabolic process, HRI-mediated signaling, integrated stress response signaling, lipid metabolic process, mitochondrial protein processing, mitochondrial respiratory chain complex assembly, mitochondrion organization, negative regulation of mitochondrial fusion, positive regulation of apoptotic process, positive regulation of cold-induced thermogenesis, protein autoprocessing, protein quality control for misfolded or incompletely synthesized proteins, regulation of cristae formation, zymogen activation 24550258 60 80:139 SSAQSKELGVLTYRCTVRGDSVLRQGARKVAGVPALAASCSPSCPAVIEARSFRTSARVQ
PSQ02017 FD00005 Bombinins BLP-7 Q9DET7 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina orientalis (Oriental fire-bellied toad) 25, 50 None 144 None None 8346 extracellular region defense response to bacterium, defense response to fungus, killing of cells of other organism 28636781;28636781 75 19:43, 74:123 RSVKNDEQSLSQRDVLEEESLREIR, TAEEHEVMKRLEAVMRDLDSLDYPEEASEMETRSFNQEEIANLFTKKEKR
PSQ02018 FD00193 Cathepsin D Q9DEX3 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Actinopterygii Neopterygii Teleostei Clupei Clupeiformes Clupeoidei Clupeidae Clupea Clupea harengus (Atlantic herring) 43 aspartic-type endopeptidase activity 396 None ctsd 7950 lysosome None 11207447 43 19:61 IVRIPLKKFRSIRRTLSDSGLNVEQLLAGTNSLQHNQGFPSSN
PSQ02019 FD00004 Snake venom serine protease 2 Q9DF67 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Protobothrops Protobothrops jerdonii (Jerdon 6 serine-type endopeptidase activity, toxin activity 258 Jerdonobin-II None 242841 extracellular region None 15683874 6 19:24 QKSSEL
PSQ02020 FND00238 Gonadotropin inhibitory hormone peptides Q9DGD4 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Galliformes Phasianidae Perdicinae Coturnix Coturnix japonica (Japanese quail) (Coturnix coturnix japonica) 6 G protein-coupled receptor binding 180 None GNIH 93934 extracellular region, neuron projection, neuronal cell body, perikaryon negative regulation of luteinizing hormone secretion, neuropeptide signaling pathway, positive regulation of appetite 10964719 6 98:103 SNPEER
PSQ02021 FD00087 Tripeptidyl-peptidase 1 Q9EQV6 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 176 endopeptidase activity, lysophosphatidic acid binding, metal ion binding, peptidase activity, peptide binding, serine-type endopeptidase activity, serine-type peptidase activity, sulfatide binding, tripeptidyl-peptidase activity 563 Tripeptidyl aminopeptidase, Tripeptidyl-peptidase I Tpp1 10116 Golgi apparatus, lysosome, melanosome, membrane raft, recycling endosome bone resorption, central nervous system development, epithelial cell differentiation, lysosomal protein catabolic process, lysosome organization, nervous system development, neuromuscular process controlling balance, peptide catabolic process, protein localization to chromosome, telomeric region, proteolysis 9659384 176 20:195 THSPEPDQRWMLPPGWVSLGRVDPEEELSLTFALKQQNLDRLSELVQAVSDPSSPRYGKYLTLEDVAELVQPSPLTLRTVQKWLLAAGARDCHSVTTQDFLTCWLSVRQAELLLPGAEFHRYVGGPAKTHIIRSPHPYQLPQALAPHVDLVAGLHRFPPLSSPRQRPEPQGVGPVG
PSQ02022 FD00072 Photosystem II reaction center protein K Q9F1K9 Bacteria Cyanobacteria Synechococcales Synechococcaceae Thermosynechococcus Thermosynechococcus elongatus (strain BP-1) 9 None 46 None psbK 197221 integral component of membrane, photosystem II reaction center, plasma membrane-derived thylakoid membrane photosynthesis 17935689, 17967798 9 1:9 MIDALVLVA
PSQ02023 FD00028 2S seed storage protein 5 Q9FH31 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 19 nutrient reservoir activity 165 Seed storage albumin 5 SESA5 3702 None pollen development 8310078 19 71:89 YEADDFELTLDVDLEDDEN
PSQ02024 FD00086 Arabinogalactan protein 22 Q9FK16 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 25 None 63 Arabinogalactan peptide 22 AGP22 3702 anchored component of membrane, plasma membrane None 15322080 25 39:63 DGTSIDQGIAYVLMMVALALTYFIH
PSQ02025 FD00160 Sucrose Q9FSV7 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida Liliopsida Poales Poaceae BOP clade Pooideae Poodae Poeae Poeae Chloroplast Group 2 (Poeae type) Loliinae Lolium Festuca arundinacea (Tall fescue) (Schedonorus arundinaceus) 106 sucrose 1F-fructosyltransferase activity, sucrose alpha-glucosidase activity 660 Sucrose 1(F)-fructosyltransferase, Sucrose 1-SST 4606 vacuole carbohydrate metabolic process 11080298 106 1:106 MESSAVVPGTTAPLLPYAYAPLPSSADDARENQSSGGVRWRVCAAVLAASALAVLIVVGLLAGGRVDRGPAGGDVASAAVPAVPMEIPRSRGKDFGVSEKASGAYS
PSQ02026 FD00174 Polygalacturonase Q9FY19 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Pinopsida Pinidae Cupressales Cupressaceae Juniperus Juniperus ashei (Ozark white cedar) 34 polygalacturonase activity 507 Major pollen allergen Jun a 2, Pectinase JNA2 13101 cell wall, extracellular region carbohydrate metabolic process, cell wall organization, fruit ripening 10944464 34 21:54 AGEDQSAQIMLDSDTKQYHRSSRNLRKRVHHARH
PSQ02027 FD00071 Chymosin Q9GK11 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Tylopoda Camelidae Camelus Camelus dromedarius (Dromedary) (Arabian camel) 42 aspartic-type endopeptidase activity 381 None CYM 9838 None digestion, proteolysis involved in cellular protein catabolic process 23633601 42 17:58 SGITRIPLHKGKTLRKALKERGLLEDFLQRQQYAVSSKYSSL
PSQ02028 FND00135 Pro-FMRFamide-related neuropeptide VF Q9GM96 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos Bos taurus (Bovine) 36 signaling receptor binding 196 FMRFamide-related peptides NPVF 9913 extracellular region negative regulation of gonadotropin secretion, neuropeptide signaling pathway 11583817 36 22:57 SNIFCTDESRMPNLYSKKNYDKYSEPRGDLGWEKER
PSQ02029 FND00037 FMRFamide-related neuropeptides Q9GSL0 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Cephalopoda Coleoidea Decapodiformes Teuthida Myopsina Loliginidae Doryteuthis Doryteuthis opalescens (California market squid) (Loligo opalescens) 40, 9, 66, 11, 12, 10, 8, 11, 11 None 331 None FMRFa 1051066 extracellular region neuropeptide signaling pathway 11060217;11060217;11060217;11060217;11060217;11060217;11060217;11060217;11060217 178 26:65, 86:94, 103:168, 184:194, 225:236, 245:254, 286:293, 302:312, 321:331 FDLAQACVESQRLSLLPICDTIFAVQQEGVQQSADDGMRS, NVPDLPFED, AAPQLDELLKQALQRVESLQKADETSVRRKRSTDAAPQNNAENPEQKNDSAKITKRYIDDVEDSDV, NPSDVGNKLTE, NPSDAEDELEED, GGEDDEEEAE, NPDEQEAD, GGEDDEVSTED, SADKCKGCLEG
PSQ02030 FND00244 Halocin-S8 Q9HHA8 Archaea Euryarchaeota Stenosarchaea group Halobacteria Halobacteriales Halobacteriaceae Haloarchaeon S8a 230 None 311 None halS8 135836 extracellular region cytolysis, defense response to bacterium 10940040 230 1:230 MSDKDSINRRNVLRKIGGIGVASAVGFSGLASGESLSDDEKQDVIDTIYKSQRVEQIKKKFGGVNIEPKKVQSVTTNQSGDLVTAKLSVSDGDLVYSSVKDTTVIVQFDRSASEIGESWPKNTEAFIKSTSSGVDLLRTATDEEIKDVTEGVNTSEIESADAVNIFIDPESQTYYMEKYDFNNKVLEMFELATGGTSSGKISPTREDQNHEYNVREHKVFNSEKQNIQLQ
PSQ02031 FD00108 Acyl-homoserine lactone acylase PvdQ Q9I194 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas aeruginosa (strain ATCC 15692 , 14847 23 ADP-dependent short-chain-acyl-CoA hydrolase activity, hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides, identical protein binding 762 None pvdQ 208964 cytoplasm, periplasmic space antibiotic biosynthetic process, bacterial-type flagellum-dependent swarming motility, pathogenesis, pyoverdine biosynthetic process, quorum sensing, response to antibiotic, single-species biofilm formation 16495538 23 194:216 ALSGEQAFQVAEQRRQRFRLERG
PSQ02032 FD00015 Zinc metalloproteinase Q9IAB0 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Agkistrodon Agkistrodon contortrix contortrix (Southern copperhead) 24 metal ion binding, metalloendopeptidase activity, toxin activity 483 None None 8713 extracellular region None 10700384 24 395:418 LRTDIVSTPVSGNELLETGEESDF
PSQ02033 FD00050 Interleukin-36 alpha Q9JLA2 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 7 cytokine activity, interleukin-1 receptor binding 160 FIL1 epsilon, Interleukin-1 epsilon, Interleukin-1 family member 6, Interleukin-1 homolog 1 Il36a 10090 cytoplasm, extracellular space cellular response to lipopolysaccharide, cytokine-mediated signaling pathway, inflammatory response, inflammatory response to antigenic stimulus, innate immune response, positive regulation of cytokine production, positive regulation of gene expression, positive regulation of interleukin-6 production 21965679 7 1:7 MNKEKEL
PSQ02034 FD00267 Pre-pro-metalloprotease PrtV Q9KMU6 Bacteria Proteobacteria Gammaproteobacteria Vibrionales Vibrionaceae Vibrio Vibrio cholerae serotype O1 (strain ATCC 39315 82, 84 metal ion binding, metallopeptidase activity, peptidase activity 918 None prtV 243277 extracellular region cytolysis, pathogenesis, proteolysis 18479458;18479458 166 24:105, 835:918 QTPIDLGVVNEDKLIEMLVRTGQIPADASDVDKRIALERYLEEKIRSGFKGDAQFGKKALEQRAKILKVIDKQKGPHKARVF, VDTPNALPQASANYIHLGRWVTMWSTSTDSDGRIVDTEWTLPNGKIKRGRMFTAIFPSYGHHDVQLKVMDDRGAVTTITIKVKL
PSQ02035 FD00036 Lantibiotic nukacin Q9KWM4 Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus warneri 30 signaling receptor binding 60 Bacteriocin ISK-1 nukA 1292 extracellular region cytolysis, defense response to bacterium 11193411 30 1:30 MENSKVMKDIEVANLLEEVQEDELNEVLGA
PSQ02036 FD00520 Actinohivin Q9KWN0 Bacteria Actinobacteria Actinomycetales Actinomycete sp 20 carbohydrate binding 160 None ath 237531 None regulation of defense response to virus 11243871, 11401502 20 27:46 APAADTTASPALGSQVSAQF
PSQ02037 FND00047 Arabinogalactan protein 12 Q9LJD9 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 22 None 60 Arabinogalactan peptide 12 AGP12 3702 anchored component of membrane, plasma membrane None 11006345, 15322080 22 39:60 DAAMFVPALFASVAALASGFLF
PSQ02038 FD00296 Rapid alkalinization factor 23 Q9LUS7 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 60 hormone activity 138 Protein RALF-like 23 RALF23 3702 apoplast, plasmodesma brassinosteroid mediated signaling pathway, calcium-mediated signaling, cell-cell signaling, negative regulation of growth, response to brassinosteroid 19473327 60 29:88 VSSQSTEFAGDFPPFETECRGTIAECSVSAALGDGGDLFYGGGEMGEEFEMDSEINRRIL
PSQ02039 FD00262 Elicitor peptide 1 Q9LV87 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 69 None 92 None PEP1 3702 None innate immune response, response to ethylene, response to jasmonic acid, response to wounding 16785434 69 1:69 MEKSDRRSEESHLWIPLQCLDQTLRAILKCLGLFHQDSPTTSSPGTSKQPKEEKEDVTMEKEEVVVTSR
PSQ02040 FND00061 Arabinogalactan protein 14 Q9LVC0 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 22 None 60 Arabinogalactan peptide 14 AGP14 3702 anchored component of membrane, plasma membrane root hair elongation 11006345, 15322080 22 39:60 DASSFIPTFFASVAVMAFGFFF
PSQ02041 FND00334 Arabinogalactan protein 15 Q9LYF6 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 26 None 61 Arabinogalactan peptide 15 AGP15 3702 anchored component of membrane, plasma membrane None 11006345, 15322080 26 36:61 SAISASFVSAGVAAVAALVFGSALRI
PSQ02042 FD00086 Arabinogalactan protein 20 Q9M373 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 37 None 74 Arabinogalactan peptide 20 AGP20 3702 anchored component of membrane, plasma membrane None 15322080 37 38:74 DGTSIDQGIAYLLMVVALVLTYLIHPLDASSSSYTFF
PSQ02043 FD00056 Subtilisin-like protease SBT3 Q9MAP5 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 87 serine-type endopeptidase activity 780 Subtilase subfamily 3 member 3 SBT3 3702 extracellular matrix, extracellular space, plant-type cell wall induced systemic resistance 23818851 87 25:111 RSETESKVHIVYLGEKKHHDPEFVTESHHQMLASLLGSKKDADDSMVYSYRHGFSGFAAKLTKSQAKKIADLPEVVHVIPDGFHELA
PSQ02044 FD00056 Subtilisin-like protease SBT3 Q9MAP7 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 85 serine-type endopeptidase activity 780 Subtilase subfamily 3 member 5 SBT3 3702 cell wall, extracellular space regulation of growth 24665109 85 24:108 SDESKVHIVYLGEKQHDDPEFVSESHHQMLSSLLGSKVDAHESMVYSYRHGFSGFAAKLTESQAKKLADSPEVVHVMADSFYELA
PSQ02045 FD00041 Delta-actitoxin-Aeq2a Q9NJQ2 Eukaryota Metazoa Cnidaria Anthozoa Hexacorallia Actiniaria Actiniidae Actinia Actinia equina (Beadlet anemone) 7 toxin activity 82 Ae1 , Ae1-1 , AeNa , Neurotoxin 1 , Neurotoxin Ae I None 6106 extracellular region, nematocyst None 8835334 7 20:26 DEDVDIA
PSQ02046 FND00043 Orcokinin peptides type B Q9NL82 Eukaryota Metazoa Ecdysozoa Arthropoda Crustacea Multicrustacea Malacostraca Eumalacostraca Eucarida Decapoda Pleocyemata Astacidea Astacoidea Cambaridae Procambarus Procambarus clarkii (Red swamp crayfish) 26, 7 neuropeptide hormone activity 266 None None 6728 extracellular region neuropeptide signaling pathway 10753578;10753578 33 21:46, 240:246 GTIKTAPARTPSTQDDASFPPDGAPV, DYDVFPD
PSQ02047 FND00043 Orcokinin peptides type A Q9NL83 Eukaryota Metazoa Ecdysozoa Arthropoda Crustacea Multicrustacea Malacostraca Eumalacostraca Eucarida Decapoda Pleocyemata Astacidea Astacoidea Cambaridae Procambarus Procambarus clarkii (Red swamp crayfish) 26, 7 neuropeptide hormone activity 251 None None 6728 extracellular region neuropeptide signaling pathway 10753578;10753578 33 21:46, 225:231 GTIKTAPARTPSTQDDASFPPDGAPV, DYDVFPD
PSQ02048 FD00050 Interleukin-37 Q9NZH6 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 45 cytokine activity, interleukin-1 receptor binding 218 FIL1 zeta, IL-1X, Interleukin-1 family member 7, Interleukin-1 homolog 4, Interleukin-1 zeta, Interleukin-1-related protein, Interleukin-23 IL37 9606 cytosol, extracellular region, extracellular space, intracellular membrane-bounded organelle, nucleoplasm cellular response to cytokine stimulus, cellular response to lipopolysaccharide, cytokine-mediated signaling pathway, immune response, inflammatory response, inflammatory response to antigenic stimulus, negative regulation of interleukin-6 production, negative regulation of tumor necrosis factor production, positive regulation of gene expression, regulation of inflammatory response 11145836 45 1:45 MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNF
PSQ02049 FD00050 Interleukin-36 gamma Q9NZH8 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 17 cytokine activity, interleukin-1 receptor binding 169 IL-1-related protein 2, Interleukin-1 epsilon, Interleukin-1 family member 9, Interleukin-1 homolog 1 IL36G 9606 cytoplasm, extracellular region, extracellular space cell-cell signaling, cellular response to lipopolysaccharide, cytokine-mediated signaling pathway, inflammatory response, inflammatory response to antigenic stimulus, innate immune response, positive regulation of gene expression 21965679 17 1:17 MRGTPGDADGGGRAVYQ
PSQ02050 FD00004 Kallikrein-14 Q9P0G3 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 6 serine-type endopeptidase activity 267 Kallikrein-like protein 6 KLK14 9606 extracellular region, extracellular space, secretory granule cornification, epidermis morphogenesis, fertilization, negative regulation of G protein-coupled receptor signaling pathway, positive regulation of G protein-coupled receptor signaling pathway, proteolysis, seminal clot liquefaction 16800737 6 35:40 QEDENK
Total Pages 43
Go to Lab Web Page