| Proseq ID | Family | Protein Name  |
Uniprot ID | Taxonomy | Organism | Prosequence length |
Functions | Preproprotein length | Alter Name | Gene Name | NCBI ID | Cell Org | Process | PubMed | Total Proseq length | Proseq Loc | Prosequence Sequence | |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PSQ01801 | FND00110 | Pro-corazonin | Q5DW47 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Apoidea Apidae Apis | Apis mellifera (Honeybee) | 20 | corazonin receptor binding, neuropeptide hormone activity | 107 | None | Crz | 7460 | extracellular region | neuropeptide signaling pathway, positive regulation of heart contraction | 16406615 | 20 | 88:107 | SFSENMINDHRQPAPTNNNY | |
| PSQ01802 | FD00003 | Conotoxin mr3e | Q5EHP3 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Conus | Conus marmoreus (Marble cone) | 30 | ion channel inhibitor activity, toxin activity | 71 | Mr3, Mr3 | None | 42752 | extracellular region | pathogenesis | 17042781 | 30 | 25:54 | DQPVERYAENKRLLNPDERRGIILHALGQR | |
| PSQ01803 | FD00003 | Conotoxin Lp3 | Q5EHP4 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Lithoconus | Conus leopardus (Leopard cone) | 31 | ion channel inhibitor activity, toxin activity | 70 | None | None | 101306 | extracellular region | pathogenesis | 17042781 | 31 | 25:55 | DQPVERYAENKQDLNPNERMKMIMSALGQRR | |
| PSQ01804 | FD00004 | Blarinasin-1 | Q5FBW2 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Eulipotyphla Soricidae Soricinae Blarina | Blarina brevicauda (Northern short-tailed shrew) | 12 | serine-type endopeptidase activity | 280 | Kallikrein-1 | KLK1 | 9387 | extracellular region | None | 15843162 | 12 | 17:28 | VPPGPSIEIHPR | |
| PSQ01805 | FD00097 | Antimicrobial peptide Ar-AMP | Q5I2B2 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae Caryophyllales Amaranthaceae Amaranthus | Amaranthus retroflexus (Redroot amaranth) (American pigweed) | 34 | chitin binding | 89 | None | None | 124763 | None | defense response to fungus, defense response to Gram-positive bacterium, killing of cells of other organism | 16126239 | 34 | 56:89 | ASTTVDHQADAAAAAATKTANNPTDAKLAGAGSP | |
| PSQ01806 | FD00003 | Conotoxin Lp3 | Q5I2P0 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Lithoconus | Conus leopardus (Leopard cone) | 34 | ion channel inhibitor activity, toxin activity | 69 | None | None | 101306 | extracellular region | pathogenesis | 17042781 | 34 | 21:54 | ELDTDRPVERHAAIKQDLKPQERRGIRLHAPRDE | |
| PSQ01807 | FD00343 | Subtilisin-like serine protease | Q5JIZ5 | Archaea Euryarchaeota Thermococci Thermococcales Thermococcaceae Thermococcus | Thermococcus kodakarensis (strain ATCC BAA-918 , (Pyrococcus kodakaraensis (strain KOD1)) | 113, 101 | calcium ion binding, peptidase activity, serine-type endopeptidase activity | 663 | Tk-SP | None | 69014 | None | proteolysis | 20100702, 20595040,;20100702, 20595040 | 214 | 24:136, 563:663 | APQKPAVRNVSQQKNYGLLTPGLFKKVQRMSWDQEVSTIIMFDNQADKEKAVEILDFLGAKIKYNYHIIPALAVKIKVKDLLIIAGLMDTGYFGNAQLSGVQFIQEDYVVKVA, DEKTFTGTVHDYYDKSDTFTMTVNSGATKITGDLYFDTSYHDLDLYLYDPNQNLVDRSESSNSYEHVEYNNPAPGTWYFLVYAYDTYGYADYQLDAKVYYG | |
| PSQ01808 | FND00123 | Arabinogalactan protein 24 | Q5PP12 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis | Arabidopsis thaliana (Mouse-ear cress) | 27 | None | 69 | Arabinogalactan peptide 24 | AGP24 | 3702 | anchored component of membrane, plasma membrane | None | 15322080 | 27 | 43:69 | SSTVVSATNMFTVLAIAAVALVVGSNH | |
| PSQ01809 | FD00549 | DELTA-thalatoxin-Avl1a | Q5R231 | Eukaryota Metazoa Cnidaria Anthozoa Hexacorallia Actiniaria Nynantheae Aliciidae Actineria | Actineria villosa (Okinawan sea anemone) | 24 | channel activity, toxin activity | 226 | Cytolysin Avt-I , Hemolytic toxin Avt-1 | None | 227975 | extracellular region, nematocyst, other organism cell membrane, pore complex | cation transport, hemolysis in other organism involved in symbiotic interaction, pore complex assembly | 15804525 | 24 | 22:45 | KKHIVTKKGNHQDITNDNEGENAE | |
| PSQ01810 | FD00158 | Halolysin-like extracellular serine protease Nep | Q5RLZ1 | Archaea Euryarchaeota Stenosarchaea group Halobacteria Natrialbales Natrialbaceae Natrialba | Natrialba magadii | 88 | serine-type endopeptidase activity | 541 | Subtilisin-like protease Nep | nep | 13769 | extracellular region | None | 18553052 | 88 | 34:121 | TPGREPGPKKDEIIVGVSERVSSTEATVESKIPTNAEIVHTNETLGYVAVKFPSNAAEQARENFKRNVLQEDDIEYAEDNATYETLEV | |
| PSQ01811 | FND00066 | Arenicin-2 | Q5SC59 | Eukaryota Metazoa Spiralia Lophotrochozoa Annelida Polychaeta Sedentaria Scolecida Arenicolidae Arenicola | Arenicola marina (Lugworm) (Lumbricus marinus) | 156 | None | 202 | None | None | 6344 | None | defense response to bacterium, defense response to fungus, killing of cells of other organism | 15527787 | 156 | 26:181 | DPIAEARAAAFGEREARSAGEWKQFDVNGEKVEVNEQENREIIRQAGGDGVEGSVMVIDHAKGLIIWSIPRAGECYLIGGVDKQLPDAQELLHYFRSAQGSADGEGVQSALDYVKAEDRPVTDLNLLAPEVREACQGKSVYWLEKSSGDNNEPEKR | |
| PSQ01812 | FND00066 | Arenicin-1 | Q5SC60 | Eukaryota Metazoa Spiralia Lophotrochozoa Annelida Polychaeta Sedentaria Scolecida Arenicolidae Arenicola | Arenicola marina (Lugworm) (Lumbricus marinus) | 156 | None | 202 | None | None | 6344 | None | defense response to bacterium, defense response to fungus, killing of cells of other organism | 15527787 | 156 | 26:181 | DPIAEARAAAFGEREARSDGEWKQFDVNGEKIEVNEQENREIIRQAGGDGVEGSVMVIDHAKGLISWSIPRAGECYLIGGVDKQLPDAQELLHYFQSAQGSADGEGVESALDYVKAEDRPVTDLNLLAPEVREACQGKSVYWLEKSSGDNNEPEKR | |
| PSQ01813 | FND00305 | Varv peptide A | Q5USN7 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Malpighiales Violaceae Viola | Viola odorata (Sweet violet) | 46, 25, 25 | None | 207 | Cyclotide k1 | Vok1 | 97441 | None | defense response, hemolysis in other organism | 16872274;16872274;16872274 | 96 | 21:66, 96:120, 150:174 | TEQDVITLQAYEELLKNGAANGMTKTVISSPVLEEALVSYSKNKLG, SLESTKSANPLLEEALTAFAKKGLG, ALETQKPNHLLEEALVAFAKKGNLG | |
| PSQ01814 | FD00034 | Cycloviolacin-O13 | Q5USN8 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Malpighiales Violaceae Viola | Viola odorata (Sweet violet) | 59 | None | 120 | Cyclotide c3 | Voc3 | 97441 | None | defense response, hemolysis in other organism | 16872274 | 59 | 23:81 | TFEKDFITPETIQAILKKSAPLSNIMLEEDVINALLKSKTVISNPIIEEAFLKNSNGLN | |
| PSQ01815 | FD00004 | Snake venom serine protease HS114 | Q5W959 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Bothrops | Bothrops jararaca (Jararaca) (Bothrops jajaraca) | 6 | serine-type endopeptidase activity, toxin activity | 258 | BjSP , Thrombin-like enzyme HS114 | None | 8724 | extracellular region | None | 30145175 | 6 | 19:24 | QKVSEL | |
| PSQ01816 | FND00071 | Mu-agatoxin-Ao1b | Q5Y4U6 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Agelenidae Agelena | Agelena orientalis (Funnel-web spider) | 13 | ion channel inhibitor activity, toxin activity | 70 | Beta, Mu-2Aaga_14 | None | 293813 | extracellular region | pathogenesis | 20385552 | 13 | 21:33 | SSLEALKIFEGER | |
| PSQ01817 | FND00071 | Mu-agatoxin-Ao1a | Q5Y4U7 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Agelenidae Agelena | Agelena orientalis (Funnel-web spider) | 13 | ion channel inhibitor activity, toxin activity | 70 | Beta, Mu-2Aaga_13 | None | 293813 | extracellular region | pathogenesis | 20385552 | 13 | 21:33 | SSLEALKIFEGER | |
| PSQ01818 | FD00021 | U3-agatoxin-Ao1k | Q5Y4U8 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Agelenidae Agelena | Agelena orientalis (Funnel-web spider) | 14 | toxin activity | 73 | Beta, Mu-2Aaga_12 | None | 293813 | extracellular region | pathogenesis | 20385552 | 14 | 21:34 | ISLEEGLQLFEGER | |
| PSQ01819 | FD00021 | U3-agatoxin-Ao1j | Q5Y4U9 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Agelenidae Agelena | Agelena orientalis (Funnel-web spider) | 14 | toxin activity | 73 | Mu-2Aaga_11 | None | 293813 | extracellular region | pathogenesis | 15688451 | 14 | 21:34 | ISLEEGLQLFEGER | |
| PSQ01820 | FD00021 | U3-agatoxin-Ao1i | Q5Y4V0 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Agelenidae Agelena | Agelena orientalis (Funnel-web spider) | 14 | toxin activity | 73 | Mu-2Aaga_10 | None | 293813 | extracellular region | pathogenesis | 15688451 | 14 | 21:34 | ISLEEGLQLFEGER | |
| PSQ01821 | FD00021 | U3-agatoxin-Ao1h | Q5Y4V1 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Agelenidae Agelena | Agelena orientalis (Funnel-web spider) | 14 | toxin activity | 74 | Mu-2Aaga_09 | None | 293813 | extracellular region | pathogenesis | 15688451 | 14 | 21:34 | VSVQKSLKIFEGER | |
| PSQ01822 | FD00021 | U3-agatoxin-Ao1g | Q5Y4V2 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Agelenidae Agelena | Agelena orientalis (Funnel-web spider) | 14 | toxin activity | 74 | Beta, Mu-2Aga_08 | None | 293813 | extracellular region | pathogenesis | 20385552 | 14 | 21:34 | VSVEEGLKIFEGER | |
| PSQ01823 | FD00021 | U3-agatoxin-Ao1f | Q5Y4V3 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Agelenidae Agelena | Agelena orientalis (Funnel-web spider) | 14 | toxin activity | 74 | Beta, Mu-2Aga_07 | None | 293813 | extracellular region | pathogenesis | 20385552 | 14 | 21:34 | VSLEEGLKIFEGER | |
| PSQ01824 | FD00021 | U3-agatoxin-Ao1e | Q5Y4V4 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Agelenidae Agelena | Agelena orientalis (Funnel-web spider) | 14 | toxin activity | 73 | Mu-2Aga_06 | None | 293813 | extracellular region | pathogenesis | 15688451 | 14 | 21:34 | ISLEEGLQLFEGER | |
| PSQ01825 | FD00021 | U3-agatoxin-Ao1c | Q5Y4V6 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Agelenidae Agelena | Agelena orientalis (Funnel-web spider) | 14 | toxin activity | 73 | Beta, Mu-2Aga_04 | None | 293813 | extracellular region | pathogenesis | 20385552 | 14 | 21:34 | ISLEEGLQLFEGER | |
| PSQ01826 | FD00021 | U3-agatoxin-Ao1a | Q5Y4V8 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Agelenidae Agelena | Agelena orientalis (Funnel-web spider) | 13 | toxin activity | 71 | Beta, Mu-2Aga_01 | None | 293813 | extracellular region | pathogenesis | 20385552 | 13 | 21:33 | VKEEGTKPAEAAR | |
| PSQ01827 | FD00109 | Venom nerve growth factor 1 | Q5YF90 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Elapidae Elapinae Naja | Naja sputatrix (Malayan spitting cobra) (Naja naja sputatrix) | 107 | growth factor activity, lipid binding, metalloendopeptidase inhibitor activity, toxin activity | 243 | Nerve growth factor I | None | 33626 | extracellular region | None | 15225125 | 107 | 19:125 | VPKSEDNAPLGSPATSDLSDTSCAQTHEGLKTSRNTDQRHPAPRSQRIKQFGSASNIIVDPKLFQKRRFQSPRVLFSTQPPPLSRDEQSVEFLDNEDALNRNIRAKR | |
| PSQ01828 | FD00118 | Alpha-2-antiplasmin | Q61247 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus | Mus musculus (Mouse) | 12 | protease binding, protein homodimerization activity, serine-type endopeptidase inhibitor activity | 491 | Alpha-2-plasmin inhibitor, Serpin F2 | Serpinf2 | 10090 | cell surface, collagen-containing extracellular matrix, extracellular space, fibrinogen complex | acute-phase response, blood vessel morphogenesis, collagen fibril organization, maintenance of blood vessel diameter homeostasis by renin-angiotensin, negative regulation of endopeptidase activity, negative regulation of fibrinolysis, negative regulation of plasminogen activation, positive regulation of cell differentiation, positive regulation of collagen biosynthetic process, positive regulation of ERK1 and ERK2 cascade, positive regulation of JNK cascade, positive regulation of smooth muscle cell proliferation, positive regulation of stress fiber assembly, positive regulation of transcription by RNA polymerase II, positive regulation of transforming growth factor beta production | 7523120 | 12 | 28:39 | VDLPGQQPVSEQ | |
| PSQ01829 | FD00088 | Proepiregulin | Q61521 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus | Mus musculus (Mouse) | 33 | epidermal growth factor receptor binding, growth factor activity | 162 | None | Ereg | 10090 | extracellular space, integral component of membrane, plasma membrane | anatomical structure morphogenesis, angiogenesis, animal organ morphogenesis, cell-cell signaling, cytokine-mediated signaling pathway, epidermal growth factor receptor signaling pathway, female meiotic nuclear division, keratinocyte proliferation, luteinizing hormone signaling pathway, mRNA transcription, negative regulation of cell population proliferation, negative regulation of smooth muscle cell differentiation, negative regulation of transcription, DNA-templated, oocyte maturation, ovarian cumulus expansion, ovulation, positive regulation of cell division, positive regulation of cell population proliferation, positive regulation of cytokine production, positive regulation of DNA replication, positive regulation of epidermal growth factor-activated receptor activity, positive regulation of fibroblast proliferation, positive regulation of innate immune response, positive regulation of interleukin-6 production, positive regulation of mitotic nuclear division, positive regulation of phosphorylation, positive regulation of protein kinase activity, positive regulation of smooth muscle cell proliferation, primary follicle stage, response to peptide hormone | 7706296 | 33 | 23:55 | VISTTVIPSCIPGESEDNCTALVQMEDDPRVAQ | |
| PSQ01830 | FD00186 | Zona pellucida sperm-binding protein 1 | Q62005 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus | Mus musculus (Mouse) | 77 | structural constituent of egg coat | 623 | Zona pellucida glycoprotein 1 | Zp1 | 10090 | collagen-containing extracellular matrix, egg coat, extracellular region, integral component of membrane, plasma membrane | single fertilization | 12799386 | 77 | 547:623 | RRSSGHHNITLRALDIVSSPGAVGFEDAAKLEPSGSSRNSSSRMLLLLLAITLALAAGIFVGLIWAWAQKLWEGIRY | |
| PSQ01831 | FD00115 | Neutrophil antibiotic peptide NP-3A | Q62713 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus | Rattus norvegicus (Rat) | 39 | None | 87 | Neutrophil defensin 3 | None | 10116 | extracellular space | antibacterial humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, cellular response to lipopolysaccharide, defense response to fungus, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, innate immune response in mucosa, killing of cells of other organism, membrane disruption in other organism | 2543629, 7594610 | 39 | 20:58 | ESPQGSTKEAPDEEQDISVFFGGDKGTALQDAAVKAGVT | |
| PSQ01832 | FD00152 | Proprotein convertase subtilisin | Q63415 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus | Rattus norvegicus (Rat) | 87 | endopeptidase activity, heparin binding, nerve growth factor binding, serine-type endopeptidase activity | 937 | Paired basic amino acid cleaving enzyme 4, Subtilisin-like proprotein convertase 4, Subtilisin | Pcsk6 | 10116 | cell surface, collagen-containing extracellular matrix, extracellular space, membrane | determination of left/right symmetry, glycoprotein metabolic process, nerve growth factor production, peptide hormone processing, protein processing, secretion by cell, zygotic determination of anterior/posterior axis, embryo | 26479776 | 87 | 46:132 | LPPPRPVYTNHWAVQVLGGPGAADRVAAAHGYLNLGQIGNLDDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQQEVKRRVKR | |
| PSQ01833 | FD00016 | Neutrophil cationic peptide 1 type B | Q64365 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Hystricomorpha Caviidae Cavia | Cavia porcellus (Guinea pig) | 43 | None | 93 | GNCP-1B | None | 10141 | extracellular space | defense response to bacterium, defense response to fungus, defense response to virus, killing of cells of other organism | 1659400, 2473036, 3623703 | 43 | 20:62 | EPLPRAADHSDTKMKGDREDHVAVISFWEEESTSLQDAGAGAG | |
| PSQ01834 | FD00197 | Ectonucleotide pyrophosphatase | Q64610 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus | Rattus norvegicus (Rat) | 8 | alkylglycerophosphoethanolamine phosphodiesterase activity, calcium ion binding, lysophospholipase activity, nucleic acid binding, nucleotide diphosphatase activity, phosphodiesterase I activity, polysaccharide binding, scavenger receptor activity, zinc ion binding | 887 | Autotaxin , Extracellular lysophospholipase D | Enpp2 | 10116 | cytoplasm, extracellular space, Golgi apparatus | cell chemotaxis, cellular response to cadmium ion, cellular response to estradiol stimulus, estrous cycle, immune response, negative regulation of cell-matrix adhesion, phosphatidylcholine catabolic process, phospholipid catabolic process, phospholipid metabolic process, positive regulation of cell population proliferation, positive regulation of epithelial cell migration, positive regulation of focal adhesion assembly, positive regulation of lamellipodium morphogenesis, positive regulation of oligodendrocyte differentiation, positive regulation of peptidyl-tyrosine phosphorylation, positive regulation of substrate adhesion-dependent cell spreading, regulation of angiogenesis, regulation of cell migration, response to polycyclic arene, sphingolipid catabolic process | 15985467, 16436050 | 8 | 28:35 | FTASRIKR | |
| PSQ01835 | FD00011 | Alkaline serine protease ver112 | Q68GV9 | Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Sordariomycetes Hypocreomycetidae Hypocreales Cordycipitaceae Lecanicillium | Lecanicillium psalliotae (Verticillium psalliotae) | 87 | serine-type endopeptidase activity | 382 | None | None | 73499 | extracellular region | None | 16132863 | 87 | 16:102 | APVAEPEIAPLIEARGAQPIAGKYIVKLKDEAKFGIMNAKSKIPGIERVYENVLNGFSATLSNEELERLRRDPDVESIEQDAIFSIN | |
| PSQ01836 | FD00077 | Phospholipase A1 | Q68KK0 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Formicoidea Formicidae Myrmicinae Solenopsis | Solenopsis invicta (Red imported fire ant) (Solenopsis wagneri) | 11 | 1-acyl-2-lysophosphatidylserine acylhydrolase activity, phosphatidylserine 1-acylhydrolase activity, phospholipase A1 activity, triglyceride lipase activity | 346 | Allergen Sol i I, Venom allergen 1, Venom allergen I | None | 13686 | extracellular region | hemolysis in other organism, lipid catabolic process | 15753912 | 11 | 27:37 | EPDPGVVEYLK | |
| PSQ01837 | FD00209 | A disintegrin and metalloproteinase with thrombospondin motifs 7 | Q68SA9 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus | Mus musculus (Mouse) | 200 | metal ion binding, metalloendopeptidase activity, metallopeptidase activity | 1657 | COMPase | Adamts7 | 10090 | cell surface, extracellular matrix, extracellular region | cellular response to BMP stimulus, cellular response to interleukin-1, cellular response to tumor necrosis factor, extracellular matrix organization, negative regulation of chondrocyte differentiation, proteolysis, proteolysis involved in cellular protein catabolic process | 15192113 | 200 | 21:220 | PASGLVTEGRAGLDIVHPVRVDAGGSFLSYELWPRVLRKRDVSTTQASSAFYQLQYQGRELLFNLTTNPYLMAPGFVSEIRRHSTLGHAHIQTSVPTCHLLGDVQDPELEGGFAAISACDGLRGVFQLSNEDYFIEPLDGVSAQPGHAQPHVVYKHQGSRKQAQQGDSRPSGTCGMQVPPDLEQQREHWEQQQQKRRQQR | |
| PSQ01838 | FD00047 | M-myrmeciitoxin-Mb2a | Q68Y22 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Formicoidea Formicidae Myrmeciinae Myrmeciini Myrmecia | Myrmecia banksi (Jack jumper ant) (Australian jumper ant) | 27 | None | 84 | M-myrmeciitoxin-Mp3a , Pilosulin-4 | None | 36171 | extracellular region | defense response to bacterium | 15246874 | 27 | 22:48 | PNVKAKALADPESDAVGFADAVGEADP | |
| PSQ01839 | FD00047 | M-myrmeciitoxin-Mb1a | Q68Y23 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Formicoidea Formicidae Myrmeciinae Myrmeciini Myrmecia | Myrmecia banksi (Jack jumper ant) (Australian jumper ant) | 24 | None | 74 | Pilosulin-3 | None | 36171 | extracellular region | defense response to bacterium | 15246874 | 24 | 27:50 | KALADPESDAVGFADAVGEADPNA | |
| PSQ01840 | FND00083 | U2-sicaritoxin-Li1a | Q6B4T3 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Haplogynae Scytodoidea Sicariidae Loxosceles | Loxosceles intermedia (Brown spider) | 13 | toxin activity | 86 | LiTx3, Toxin 3 | None | 58218 | extracellular region | None | 15302533 | 13 | 21:33 | EEAMKDDSEPAER | |
| PSQ01841 | FND00272 | U1-sicaritoxin-Li1b | Q6B4T4 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Haplogynae Scytodoidea Sicariidae Loxosceles | Loxosceles intermedia (Brown spider) | 17 | toxin activity | 105 | LiTx2 | None | 58218 | extracellular region | None | 15302533 | 17 | 20:36 | EFESDAEKWEALITQER | |
| PSQ01842 | FND00121 | U1-sicaritoxin-Li1a | Q6B4T5 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Haplogynae Scytodoidea Sicariidae Loxosceles | Loxosceles intermedia (Brown spider) | 16 | toxin activity | 101 | LiTx1 | None | 58218 | extracellular region | None | 15302533 | 16 | 20:35 | FESDAETFKSLVVEER | |
| PSQ01843 | FND00136 | Propionicin-F | Q6E3K9 | Bacteria Actinobacteria Propionibacteriales Propionibacteriaceae Propionibacterium | Propionibacterium freudenreichii subsp | 101, 111 | None | 255 | None | pcfA | 66712 | extracellular region | cytolysis, defense response to Gram-positive bacterium | 15574930;15574930 | 212 | 1:101, 145:255 | MNTKAVNLKSENTTKLVSYLTENQLDEFIRRIRIDGALVEEVSQNAKQALDNTGLNGWINTDCDEGLLSDFISKIASARWIPLAESIRPAVTDRDKYRVSC, GTPTPPKDKSSQYKEVPLAVRLSETYHEEGVRGLFDELNYSESRMISTLRRASTDGVLINSWNDGQDTILLKKYNFQDLQLTVRSRIVGNQTIIEECKITDGRKTLSDETV | |
| PSQ01844 | FD00112 | Conglutin beta 2 | Q6EBC1 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade genistoids sensu lato core genistoids Genisteae Lupinus | Lupinus albus (White lupine) (Lupinus termis) | 78 | nutrient reservoir activity | 540 | None | None | 3870 | None | None | 20066045, 9299789 | 78 | 31:108 | EKDVLKSHERPEEREQEEWQPRRQRPQSRREEREQEQEQGSPSYPRRQSGYERRQYHERSEQREEREQEQQQGSPSYS | |
| PSQ01845 | FD00364 | Heterotepalin-4 | Q6EH50 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae Caryophyllales Phytolaccaceae Phytolacca | Phytolacca heterotepala (Mexican pokeweed) | 29 | hydrolase activity, rRNA N-glycosylase activity, toxin activity | 312 | Ribosome-inactivating protein , rRNA N-glycosidase | RIP1 | 248308 | None | defense response, negative regulation of translation | 17258249 | 29 | 284:312 | YNQNAMFPQLIMSTYYNYMANLGDLFEEF | |
| PSQ01846 | FD00260 | Replication stress response regulator SDE2 | Q6IQ49 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo | Homo sapiens (Human) | 77 | damaged DNA binding | 451 | None | SDE2 | 9606 | cytosol, Golgi apparatus, nuclear speck, nucleoplasm, nucleus, plasma membrane | cell cycle, cell division, cellular response to UV, DNA replication, protein processing, protein ubiquitination, regulation of cell cycle arrest | 27906959 | 77 | 1:77 | MAEAAALVWIRGPGFGCKAVRCASGRCTVRDFIHRHCQDQNVPVENFFVKCNGALINTSDTVQHGAVYSLEPRLCGG | |
| PSQ01847 | FD00554 | Cysteine protease avirulence protein AvrRpt2 | Q6LAD6 | Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas | Pseudomonas syringae pv | 71 | cysteine-type peptidase activity | 255 | None | avrRpt2 | 323 | extracellular region, host cell plasma membrane, membrane | modulation by symbiont of host defense-related programmed cell death, pathogenesis | 10361296 | 71 | 1:71 | MKIAPVAINHSPLSREVPSHAAPTQAKQTNLQSEAGDLDARKSSASSPETRALLATKTVLGRHKIEVPAFG | |
| PSQ01848 | FD00037 | Bradykinin-potentiating and C-type natriuretic peptides | Q6LEM5 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Bothrops | Bothrops jararaca (Jararaca) (Bothrops jajaraca) | 7 | hormone activity, metalloendopeptidase inhibitor activity, peptidyl-dipeptidase inhibitor activity, toxin activity | 256 | BPP-CNP | None | 8724 | cytosol, extracellular region | blood vessel diameter maintenance, negative regulation of protein kinase activity, regulation of blood pressure, vasodilation | 15245866 | 7 | 78:84 | LTVQQWA | |
| PSQ01849 | FD00200 | Conotoxin Lp5 | Q6PN80 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Lithoconus | Conus leopardus (Leopard cone) | 35 | toxin activity | 68 | None | None | 101306 | extracellular region | None | 16604269 | 35 | 20:54 | KSLETRIQNDLIRAGLTDADLKTEKGFLSGLLNVA | |
| PSQ01850 | FD00014 | Conotoxin Lp5 | Q6PN81 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Lithoconus | Conus leopardus (Leopard cone) | 28 | toxin activity | 65 | Tau 5 | None | 101306 | extracellular region | None | 16604269 | 28 | 23:50 | QRKTKDDVPLASFHDNAKRTLKRLWNKR |
Total Pages 43
