Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
Preproprotein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Download whole result Csv
Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions Preproprotein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ01751 FND00156 Neuropeptide CCHamide-1 Q4V4I9 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 144 neuropeptide hormone activity 182 None CCHa1 7227 extracellular space neuropeptide signaling pathway 21214272, 23293632 144 39:182 SGGKAVIDAKQHPLPNSYGLDSVVEQLYNNNNNNQNNQDDDNNDDDSNRNTNANSANNIPLAAPAIISRRESEDRRIGGLKWAQLMRQHRYQLRQLQDQQQQGRGRGGQGQYDAAAESWRKLQQALQAQIDADNENYSGYELTK
PSQ01752 FND00301 Trissin Q4V645 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Ephydroidea Drosophilidae Drosophila Sophophora Drosophila melanogaster (Fruit fly) 52 G protein-coupled receptor binding 108 None Trissin 7227 extracellular space G protein-coupled receptor signaling pathway 21939639 52 57:108 RKRSDPDALRQSSNRRLIDFILLQGRALFTQELRERRHNGTLMDLGLNTYYP
PSQ01753 FD00070 Tripeptidyl-peptidase sed4 Q4WQU0 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Eurotiales Aspergillaceae Aspergillus Aspergillus subgen Fumigati Neosartorya fumigata (strain ATCC MYA-4609 , A1100) (Aspergillus fumigatus) 167 endopeptidase activity, metal ion binding, serine-type endopeptidase activity, tripeptidyl-peptidase activity 600 Sedolisin-D sed4 330879 extracellular space pathogenesis, proteolysis 16517617 167 21:187 VVQEKLSAVPSGWTLIEDASESDTITLSIALARQNLDQLESKLTTLATPGNPEYGKWLDQSDIESLFPTASDDAVLQWLKAAGITQVSRQGSLVNFATTVGTANKLFDTKFSYYRNGASQKLRTTQYSIPDHLTESIDLIAPTVFFGKEQNSALSSHAVKLPALPRR
PSQ01754 FD00515 Caspase b Q504J1 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Actinopterygii Neopterygii Teleostei Ostariophysi Cypriniformes Danionidae Danioninae Danio Danio rerio (Zebrafish) (Brachydanio rerio) 171 cysteine-type endopeptidase activity, cysteine-type endopeptidase activity involved in apoptotic signaling pathway, enzyme activator activity, lipopolysaccharide binding 404 Caspase 19a caspb 7955 cytoplasm, inflammasome complex defense response to bacterium, execution phase of apoptosis, inflammatory response, innate immune response, positive regulation of apoptotic process, pyroptosis 30076291 171 1:171 MEDITQLLSDVLEDLVESELKQFTRQLWIGVKPGVEPIPRGKLENKDRQDVVDSMVQQYSEDAGTITVQTLRKIKQNERAKRLESNLLKVQSQGQENKQNSEEPQPIPQIISQPIQQIISQPINNAGSEDLQPIQADWQRPRQIIPCSQETKNTLLKAHGDDIYTPRSGTQ
PSQ01755 FD00573 Lys-gingipain W83 Q51817 Bacteria Bacteroidetes Bacteroidia Bacteroidales Porphyromonadaceae Porphyromonas Porphyromonas gingivalis 204 calcium ion binding, cysteine-type endopeptidase activity 1739 Lysine specific cysteine protease , Lysine-specific cysteine proteinase , Porphypain , PrtK48 kgp 837 extracellular region hemolysis in other organism, pathogenesis, proteolysis 9245829 204 25:228 KLDAPTTRTTCTNNSFKQFDASFSFNEVELTKVETKGGTFASVSIPGAFPTGEVGSPEVPAVRKLIAVPVGATPVVRVKSFTEQVYSLNQYGSEKLMPHQPSMSKSDDPEKVPFVYNAAAYARKGFVGQELTQVEMLGTMRGVRIAALTINPVQYDVVANQLKVRNNIEIEVSFQGADEVATQRLYDASFSPYFETAYKQLFNR
PSQ01756 FD00063 Major fimbrium subunit FimA type-2 Q51822 Bacteria Bacteroidetes Bacteroidia Bacteroidales Porphyromonadaceae Porphyromonas Porphyromonas gingivalis 28 structural molecule activity 384 Fimbrillin, Major fimbrial subunit protein type II fimA 837 cell outer membrane, pilus cell adhesion, pathogenesis 1987052 28 19:46 CNKDNEAEPVTEGNATISVVLKTSNPNR
PSQ01757 FD00063 Major fimbrium subunit FimA type-4 Q51827 Bacteria Bacteroidetes Bacteroidia Bacteroidales Porphyromonadaceae Porphyromonas Porphyromonas gingivalis 27 structural molecule activity 388 Fimbrillin, Major fimbrial subunit protein type IV fimA 837 cell outer membrane, pilus cell adhesion, pathogenesis 1987052 27 19:45 CNKDNEAEPIVETDATVSFIIKSGEGR
PSQ01758 FD00191 Autophagy-related protein 8 Q51MW4 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Sordariomycetes Sordariomycetidae Magnaporthales Pyriculariaceae Pyricularia Magnaporthe oryzae (strain 70-15 , fungus) (Pyricularia oryzae) 7 None 123 Autophagy-related ubiquitin-like modifier ATG8 ATG8 242507 autophagosome membrane, cytoplasmic vesicle autophagic cell death, autophagy, pathogenesis, positive regulation of macroautophagy, protein transport 19923912 7 117:123 DLFEEVE
PSQ01759 FND00140 Cell-cell adhesion glycoprotein 64 Q52085 Eukaryota Amoebozoa Evosea Eumycetozoa Dictyostelia Acytosteliales Acytosteliaceae Heterostelium Heterostelium pallidum (Cellular slime mold) (Polysphondylium pallidum) 22 None 320 Contact site 1 gp64 13642 anchored component of membrane, plasma membrane cell adhesion, multicellular organism development 8276846 22 299:320 SATTIAFNAFVVFAIVLSVLLF
PSQ01760 FD00067 Proteasome subunit beta 1 Q53079 Bacteria Actinobacteria Corynebacteriales Nocardiaceae Rhodococcus Rhodococcus erythropolis (Arthrobacter picolinophilus) 65 endopeptidase activity, threonine-type endopeptidase activity 300 20S proteasome beta subunit 1 , Proteasome core protein PrcB 1 prcB1 1833 cytoplasm, proteasome core complex, beta-subunit complex modification-dependent protein catabolic process, proteasomal protein catabolic process 7583123 65 1:65 MTADRPALRTGDRDTRLSFGSNLSSFTDYLRGHAPELLPENRIGHRSHSTRGGDGMESGDLAPHG
PSQ01761 FD00067 Proteasome subunit beta 2 Q53083 Bacteria Actinobacteria Corynebacteriales Nocardiaceae Rhodococcus Rhodococcus erythropolis (Arthrobacter picolinophilus) 59 endopeptidase activity, threonine-type endopeptidase activity 299 20S proteasome beta subunit 2 , Proteasome core protein PrcB 2 prcB2 1833 cytoplasm, proteasome core complex, beta-subunit complex modification-dependent protein catabolic process, proteasomal protein catabolic process 7583123 59 1:59 MTVDRAPRITDGDTRLSFGSNLSSFSEYLRVHAPEHLPQNRFADTGGVVMGGGDVAPHG
PSQ01762 FD00112 Conglutin beta 1 Q53HY0 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade genistoids sensu lato core genistoids Genisteae Lupinus Lupinus albus (White lupine) (Lupinus termis) 78 nutrient reservoir activity 538 Protein Lup-1 None 3870 None None 9299789 78 31:108 EKDVLKSHERPEEREQEEWQPRRQRPQSRREEREQEQEQGSPSYPRRQSGYERRQYHERSEQREEREQEQQQGSPSYS
PSQ01763 FD00046 Fungal defensin plectasin Q53I06 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Pezizomycetes Pezizales Sarcosomataceae Pseudoplectania Pseudoplectania nigrella (Ebony cup) 32 toxin activity 95 None DEF 96584 extracellular region, host cell plasma membrane, membrane defense response to bacterium 16222292 32 24:55 APQPVPEAYAVSDPEAHPDDFAGMDANQLQKR
PSQ01764 FD00214 Retroviral-like aspartic protease 1 Q53RT3 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 190, 17 aspartic-type endopeptidase activity 343 Skin-specific retroviral-like aspartic protease, TPA-inducible aspartic proteinase-like protein ASPRV1 9606 integral component of membrane protein processing, skin development 16098038;16098038 207 1:190, 327:343 MGSPGASLGIKKALQSEQATALPASAPAVSQPTAPAPSCLPKAGQVIPTLLREAPFSSVIAPTLLCGFLFLAWVAAEVPEESSRMAGSGARSEEGRRQHAFVPEPFDGANVVPNLWLHSFEVINDLNHWDHITKLRFLKESLRGEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFAN, LIEEDPSSEEGRQELSH
PSQ01765 FD00287 Photosystem II 12 kDa extrinsic protein Q55332 Bacteria Cyanobacteria Synechococcales Merismopediaceae Synechocystis unclassified Synechocystis Synechocystis sp 8 None 131 PS II complex 12 kDa extrinsic protein, PSII-U psbU 1111708 extrinsic component of membrane, photosystem II oxygen evolving complex, plasma membrane-derived thylakoid membrane, plasma membrane-derived thylakoid photosystem II photosynthesis, photosystem II stabilization 12069591, 9211937 8 29:36 LTPNPILA
PSQ01766 FD00068 Proteasome subunit beta type-6 Q55GJ6 Eukaryota Amoebozoa Evosea Eumycetozoa Dictyostelia Dictyosteliales Dictyosteliaceae Dictyostelium Dictyostelium discoideum (Slime mold) 14 endopeptidase activity, peptidase activity, threonine-type endopeptidase activity 214 Differentiation-associated proteasome subunit 1 psmB6 44689 cytoplasm, nucleus, proteasome core complex, proteasome core complex, beta-subunit complex proteasomal ubiquitin-independent protein catabolic process, proteasome-mediated ubiquitin-dependent protein catabolic process, proteolysis 8130037 14 1:14 MEAPEWLDNAVDLG
PSQ01767 FD00501 Exo-beta-D-glucosaminidase Q56F26 Bacteria Actinobacteria Pseudonocardiales Pseudonocardiaceae Amycolatopsis Amycolatopsis orientalis (Nocardia orientalis) 14 carbohydrate binding, exo-1,4-beta-D-glucosaminidase activity, hydrolase activity, hydrolyzing O-glycosyl compounds 1032 Exochitinase csxA 31958 extracellular region chitin catabolic process, polysaccharide catabolic process 16316314 14 33:46 ATGAEVAVPLSVGA
PSQ01768 FD00017 Venom prothrombin activator pseutarin-C catalytic subunit Q56VR3 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Elapidae Acanthophiinae Pseudonaja Pseudonaja textilis (Eastern brown snake) 18 calcium ion binding, peptidase activator activity, serine-type endopeptidase activity, toxin activity 467 Venom coagulation factor Xa-like protease None 8673 extracellular region, protein-containing complex blood coagulation, envenomation resulting in positive regulation of blood coagulation in other organism, positive regulation of blood coagulation in other organism 12362232, 15351847 18 23:40 NVFLKSKVANRFLQRTKR
PSQ01769 FND00276 Frenatin 4 Q571V3 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Pelodryadinae Nyctimystes Nyctimystes infrafrenatus (White-lipped tree frog) (Litoria infrafrenata) 24 None 70 None None 61195 extracellular region, membrane, other organism cell membrane defense response to bacterium, innate immune response 27792198 24 23:46 EEEKREEENKEEEDENEALSEVKR
PSQ01770 FD00002 Frenatin 3 Q571V4 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Pelodryadinae Nyctimystes Nyctimystes infrafrenatus (White-lipped tree frog) (Litoria infrafrenata) 24 None 73 None None 61195 extracellular region defense response to bacterium, innate immune response 15996792 24 23:46 EKEKREDQNEEEVDENEEASEEKR
PSQ01771 FND00014 Frenatin 1 Q571V6 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Pelodryadinae Nyctimystes Nyctimystes infrafrenatus (White-lipped tree frog) (Litoria infrafrenata) 27 None 63 None None 61195 extracellular region defense response to bacterium, innate immune response 15996792 27 23:49 EKEKKEQEDEDENEEEKESEEGSEEKR
PSQ01772 FND00269 Lantibiotic epilancin Q57312 Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus epidermidis 24 signaling receptor binding 60 None elkA 1282 None cytolysis, defense response to bacterium 7607233 24 1:24 MNNSLFDLNLNKGVETQKSDLSPQ
PSQ01773 FD00201 Metacaspase-2 Q585F3 Eukaryota Discoba Euglenozoa Kinetoplastea Metakinetoplastina Trypanosomatida Trypanosomatidae Trypanosoma Trypanosoma brucei brucei (strain 927 55 cysteine-type endopeptidase activity, cysteine-type peptidase activity, metal ion binding 347 TbMCA2 MCA2 185431 nucleus, recycling endosome proteolysis 18005666 55 1:55 MCSLITQLCDAGQLADYVGLGWLNAVSSQPYLVQALGLQPPPRRVDVDAAFRDAK
PSQ01774 FD00005 Maximins 3 Q58T40 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 25 None 144 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 25 19:43 RSVQNDEQSLSQRDVLEEESLREIR
PSQ01775 FD00005 Maximins 4 Q58T42 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 45 None 139 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 45 74:118 TAEEHEVMKRLEAVMRDLDSLDHPEEASERETRGFNQDEIAKEKR
PSQ01776 FD00005 Maximins 3 Q58T43 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 25 None 144 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 25 19:43 RSVQNDEQSLSQRDVLEEESLREIR
PSQ01777 FD00005 Maximins 4 Q58T44 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 45 None 139 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 45 74:118 TAEEHEVMKRLEAVMRDLDSLDHPEEASERETRGFNQDEIAKEKR
PSQ01778 FD00005 Maximins 10 Q58T45 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 50 None 144 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 50 74:123 TAEDHEVMKRLEAVMRDLDSLDYPEEATERETRGFNQEEIANLFTKKEKR
PSQ01779 FD00005 Maximins 3 Q58T46 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 25 None 144 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 25 19:43 RSVQNDEQSLSQRDVLEEESLREIR
PSQ01780 FD00005 Maximins 3 Q58T48 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 25 None 144 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 25 19:43 RSVQNDEQSLSQRDVLEEESLREIR
PSQ01781 FD00005 Maximins 2 Q58T49 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 25 None 144 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 25 19:43 RSEENEIQSLSQRDVLEEESLREMR
PSQ01782 FD00005 Maximins 4 Q58T52 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 50 None 144 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 50 74:123 TAEDHEVMKRLEAVMRDLDSLDHPEEASERQTRGFNQEEIANLFTKKEKR
PSQ01783 FD00111 Maximins 9 Q58T55 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 50 None 144 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 50 74:123 TAEEHEVMKRLEAIMRDLDSLDHPEEASERETRGFNQDEIANLFTKKEKR
PSQ01784 FD00005 Maximins 5 Q58T60 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 51 None 145 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 51 74:124 TAEEQHEVMKRLEAVMRDLDSLDHPEEASERETRGFNQEEIANLFTKKEKR
PSQ01785 FD00005 Maximins 5 Q58T61 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 50 None 144 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 50 74:123 TAEDHEEMKRLEAVMRDLDSLDYPEEASERETRGFNQEEIANLFTKKEKR
PSQ01786 FD00005 Maximins 4 Q58T62 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 45 None 139 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 45 74:118 TAEDHEVMKRLEAVMRDLDSLDHPEEASERETRGFNQDEIAKEKR
PSQ01787 FD00005 Maximins 3 Q58T64 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 25 None 144 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 25 19:43 RSVQNDEQSLSQRDVLEEESLREIR
PSQ01788 FD00005 Maximins 3 Q58T65 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 25 None 145 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 25 19:43 RSVQNDEQSLSQRDVLEEEESLREI
PSQ01789 FD00005 Maximins 3 Q58T68 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 51 None 145 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 51 74:124 RIAEDHEVMKRLEAVMRDLDSLDHPEEASERETRGFNQEEIANLFTKKEKR
PSQ01790 FD00005 Maximins 3 Q58T70 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 51 None 145 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 51 74:124 RTAEEHEVMKRLEAVMRDLDSLDYPEEAAERETRGFNQDEIANLFTKKEKR
PSQ01791 FD00111 Maximins 7 Q58T74 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 50 None 144 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 50 74:123 TAEDHEVMKRLEAVMRDLDSLDYPEEAAERETRGFNQEEIANLFTKKEKR
PSQ01792 FD00005 Maximins 4 Q58T77 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 45 None 139 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 45 74:118 TAEDHEVMKRLEAIMRDLDSLDYPEEASERETRGFNQDEIAKEKR
PSQ01793 FD00005 Maximins 4 Q58T79 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 50 None 144 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 50 74:123 TAEDHEVMKRLEAVMRDLDSLDHPEEASERETRGFNQEEIANLFTKKEKR
PSQ01794 FD00005 Maximins 3 Q58T80 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 25 None 144 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 25 19:43 RSVQNDEQSLSQRDVLEEESLREIR
PSQ01795 FD00005 Maximins 3 Q58T83 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 50 None 144 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 50 74:123 TAEEHEVMKRLEAVMRDLDSLDYPEEASERETRGFNQDEIANLFTKKEKR
PSQ01796 FD00005 Maximins 2 Q58T86 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 25 None 144 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 25 19:43 RSEENEIQSLSQRDVLEEESLREIR
PSQ01797 FD00005 Maximins 1 Q58T87 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Bombinatoridae Bombina Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad) 25 None 144 None None 161274 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 11835991 25 19:43 RSEENDEQSLSQRDVLEEESLREIR
PSQ01798 FD00187 Aminopeptidase 2 Q59KZ1 Eukaryota Fungi Dikarya Ascomycota Saccharomycotina Saccharomycetes Saccharomycetales Debaryomycetaceae Candida/Lodderomyces clade Candida Candida albicans (strain SC5314 12 metalloaminopeptidase activity, peptide binding, zinc ion binding 924 None APE2 237561 cell wall, cytoplasm, extracellular region peptide catabolic process, proteolysis 18637841 12 46:57 LCHLCEKSNLWL
PSQ01799 FD00002 Dermatoxin-S1 Q5DVA5 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Phyllomedusa Phyllomedusa sauvagei (Sauvage 22 None 77 Dermatoxin DRT-S 8395 extracellular region, membrane, other organism cell membrane defense response to bacterium, innate immune response 15927704 22 23:44 ENDKREGENEEEQDDDQSEEKR
PSQ01800 FND00038 Phylloxin-S1 Q5DVA6 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Phyllomedusa Phyllomedusa sauvagei (Sauvage 22 None 64 Phylloxin PLX-S 8395 extracellular region defense response to bacterium, innate immune response 15927704 22 23:44 EENKREEHEEVEENAEKAEEKR
Total Pages 43
Go to Lab Web Page