Details of PSQ01972
| ProSeqID |
PSQ01972 |
| Family |
FD00569 |
| Protein Name |
72 kDa type IV collagenase |
| UniProt ID |
Q90611
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Archelosauria-Archosauria-Dinosauria-Saurischia-Theropoda-Coelurosauria-Aves-Neognathae-Galloanserae-Galliformes-Phasianidae-Phasianinae-Gallus |
| Organisms |
Gallus gallus (Chicken) |
| Prosequence Length (aa) |
80 |
| Functions |
metalloendopeptidase activity, zinc ion binding |
| Preproprotein Length (aa) |
663 |
| Alt Name |
72 kDa gelatinase, Gelatinase A, Matrix metalloproteinase-2 |
| Gene Name |
MMP2 |
| NCBI ID |
9031 |
| Cellular Localization |
basement membrane, collagen-containing extracellular matrix, extracellular space, plasma membrane, sarcomere |
| Processes |
blood vessel maturation, bone trabecula formation, cellular response to amino acid stimulus, cellular response to insulin-like growth factor stimulus, cellular response to reactive oxygen species, cellular response to UV-A, collagen catabolic process, endodermal cell differentiation, extracellular matrix organization, face morphogenesis, intramembranous ossification, negative regulation of cartilage condensation, negative regulation of cartilage development, negative regulation of focal adhesion assembly, negative regulation of protein phosphorylation, positive regulation of vascular associated smooth muscle cell proliferation, regulation of MAPK cascade, response to amyloid-beta, response to hypoxia, tissue remodeling |
| PubMed |
1848240
|
| Total Prosequence Length (aa) |
80 |
| Prosequence Location |
27:106 |
| Prosequence Sequence |
APSPIIKFPGDSTPKTDKELAVQYLNKYYGCPKDNCNLFVLKDTLKKMQKFFGLPETGDLDQNTIETMKKPRCGNPDVAN |
| Preproprotein Sequence |
MKTHSVFGFFFKVLLIQVYLFNKTLAAPSPIIKFPGDSTPKTDKELAVQYLNKYYGCPKDNCNLFVLKDTLKKMQKFFGLPETGDLDQNTIETMKKPRCGNPDVANYNFFPRKPKWEKNHITYRIIGYTPDLDPETVDDAFARAFKVWSDVTPLRFNRINDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGPGIGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFWFNGKEYNSCTDAGRNDGFLWCSTTKDFDADGKYGFCPHESLFTMGGNGDGQPCKFPFKFQGQSYDQCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFIFLGNKYDSCTSAGRNDGKLWCASTSSYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSEDPGALMAPIYTYTKNFRLSQDDIKGIQELYEVSPDVEPGPGPGPGPGPRPTLGPVTPELCKHDIVFDGVAQIRGEIFFFKDRFMWRTVNPRGKPTGPLLVATFWPDLPEKIDAVYESPQDEKAVFFAGNEYWVYTASNLDRGYPKKLTSLGLPPDVQRIDAAFNWGRNKKTYIFSGDRYWKYNEEKKKMELATPKFIADSWNGVPDNLDAVLGLTDSGYTYFFKDQYYLQMEDKSLKIVKIGKISSDWLGC |
