Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01956

ProSeqID PSQ01956
Family FD00050
Protein Name Interleukin-36 gamma
UniProt ID Q8R460
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Mus-Mus
Organisms Mus musculus (Mouse)
Prosequence Length (aa) 12
Functions cytokine activity
Preproprotein Length (aa) 164
Alt Name Interleukin-1 family member 9
Gene Name Il36g
NCBI ID 10090
Cellular Localization cytoplasm, extracellular space
Processes cellular response to lipopolysaccharide, cytokine-mediated signaling pathway, inflammatory response, inflammatory response to antigenic stimulus, innate immune response, negative regulation of myoblast differentiation, negative regulation of myoblast fusion, positive regulation of cytokine production, positive regulation of gene expression, positive regulation of interleukin-6 production
PubMed 21965679
Total Prosequence Length (aa) 12
Prosequence Location 1:12
Prosequence Sequence MFSKHPFSTHIS
Preproprotein Sequence MFSKHPFSTHISGRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS