Details of PSQ01997
| ProSeqID |
PSQ01997 |
| Family |
FD00203 |
| Protein Name |
Proheparin-binding EGF-like growth factor |
| UniProt ID |
Q99075
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo |
| Organisms |
Homo sapiens (Human) |
| Prosequence Length (aa) |
43 |
| Functions |
epidermal growth factor receptor binding, growth factor activity, heparin binding |
| Preproprotein Length (aa) |
208 |
| Alt Name |
None |
| Gene Name |
HBEGF |
| NCBI ID |
9606 |
| Cellular Localization |
cell surface, clathrin-coated endocytic vesicle membrane, endocytic vesicle membrane, extracellular region, extracellular space, integral component of plasma membrane, plasma membrane |
| Processes |
cell chemotaxis, epidermal growth factor receptor signaling pathway, ERBB2 signaling pathway, MAPK cascade, membrane organization, muscle organ development, negative regulation of elastin biosynthetic process, negative regulation of epidermal growth factor receptor signaling pathway, positive regulation of cell growth, positive regulation of cell migration, positive regulation of cell population proliferation, positive regulation of epidermal growth factor-activated receptor activity, positive regulation of keratinocyte migration, positive regulation of protein kinase B signaling, positive regulation of smooth muscle cell proliferation, positive regulation of wound healing, regulation of cell motility, regulation of heart contraction, signal transduction, wound healing, spreading of epidermal cells |
| PubMed |
1556128
|
| Total Prosequence Length (aa) |
43 |
| Prosequence Location |
20:62 |
| Prosequence Sequence |
LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVR |
| Preproprotein Sequence |
MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH |
