Details of PSQ01981
| ProSeqID |
PSQ01981 |
| Family |
FD00225 |
| Protein Name |
Sortilin-related receptor |
| UniProt ID |
Q92673
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo |
| Organisms |
Homo sapiens (Human) |
| Prosequence Length (aa) |
53 |
| Functions |
amyloid-beta binding, low-density lipoprotein particle binding, low-density lipoprotein particle receptor activity, neuropeptide binding, small GTPase binding, transmembrane signaling receptor activity |
| Preproprotein Length (aa) |
2220 |
| Alt Name |
Low-density lipoprotein receptor relative with 11 ligand-binding repeats, SorLA-1 , Sorting protein-related receptor containing LDLR class A repeats |
| Gene Name |
SORL1 |
| NCBI ID |
9606 |
| Cellular Localization |
cell surface, early endosome, early endosome membrane, endoplasmic reticulum, endoplasmic reticulum membrane, endosome, endosome membrane, extracellular exosome, extracellular space, Golgi apparatus, Golgi cisterna, Golgi membrane, integral component of membrane, integral component of plasma membrane, membrane, multivesicular body, multivesicular body membrane, nuclear envelope lumen, perinucleolar compartment, plasma membrane, recycling endosome, recycling endosome membrane, trans-Golgi network, transport vesicle membrane |
| Processes |
adaptive thermogenesis, amyloid fibril formation, diet induced thermogenesis, insulin receptor recycling, negative regulation of amyloid-beta formation, negative regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process, negative regulation of BMP signaling pathway, negative regulation of MAP kinase activity, negative regulation of metalloendopeptidase activity involved in amyloid precursor protein catabolic process, negative regulation of neurofibrillary tangle assembly, negative regulation of neurogenesis, negative regulation of neuron death, negative regulation of protein binding, negative regulation of protein-containing complex assembly, negative regulation of tau-protein kinase activity, negative regulation of triglyceride catabolic process, neuropeptide signaling pathway, positive regulation of adipose tissue development, positive regulation of choline O-acetyltransferase activity, positive regulation of early endosome to recycling endosome transport, positive regulation of endocytic recycling, positive regulation of ER to Golgi vesicle-mediated transport, positive regulation of glial cell-derived neurotrophic factor production, positive regulation of insulin receptor signaling pathway, positive regulation of protein catabolic process, positive regulation of protein exit from endoplasmic reticulum, positive regulation of protein localization to early endosome, post-Golgi vesicle-mediated transport, protein localization to Golgi apparatus, protein maturation, protein retention in Golgi apparatus, protein targeting, protein targeting to lysosome, receptor-mediated endocytosis, regulation of smooth muscle cell migration |
| PubMed |
8940146
|
| Total Prosequence Length (aa) |
53 |
| Prosequence Location |
29:81 |
| Prosequence Sequence |
EVWTQRLHGGSAPLPQDRGFLVVQGDPRELRLWARGDARGASRADEKPLRRKR |
| Preproprotein Sequence |
MATRSSRRESRLPFLFTLVALLPPGALCEVWTQRLHGGSAPLPQDRGFLVVQGDPRELRLWARGDARGASRADEKPLRRKRSAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFADAYAQYLWITFDFCNTLQGFSIPFRAADLLLHSKASNLLLGFDRSHPNKQLWKSDDFGQTWIMIQEHVKSFSWGIDPYDKPNTIYIERHEPSGYSTVFRSTDFFQSRENQEVILEEVRDFQLRDKYMFATKVVHLLGSEQQSSVQLWVSFGRKPMRAAQFVTRHPINEYYIADASEDQVFVCVSHSNNRTNLYISEAEGLKFSLSLENVLYYSPGGAGSDTLVRYFANEPFADFHRVEGLQGVYIATLINGSMNEENMRSVITFDKGGTWEFLQAPAFTGYGEKINCELSQGCSLHLAQRLSQLLNLQLRRMPILSKESAPGLIIATGSVGKNLASKTNVYISSSAGARWREALPGPHYYTWGDHGGIITAIAQGMETNELKYSTNEGETWKTFIFSEKPVFVYGLLTEPGEKSTVFTIFGSNKENVHSWLILQVNATDALGVPCTENDYKLWSPSDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDLSLEVCVPDPEFSGKSYSPPVPCPVGSTYRRTRGYRKISGDTCSGGDVEARLEGELVPCPLAEENEFILYAVRKSIYRYDLASGATEQLPLTGLRAAVALDFDYEHNCLYWSDLALDVIQRLCLNGSTGQEVIINSGLETVEALAFEPLSQLLYWVDAGFKKIEVANPDGDFRLTIVNSSVLDRPRALVLVPQEGVMFWTDWGDLKPGIYRSNMDGSAAYHLVSEDVKWPNGISVDDQWIYWTDAYLECIERITFSGQQRSVILDNLPHPYAIAVFKNEIYWDDWSQLSIFRASKYSGSQMEILANQLTGLMDMKIFYKGKNTGSNACVPRPCSLLCLPKANNSRSCRCPEDVSSSVLPSGDLMCDCPQGYQLKNNTCVKQENTCLRNQYRCSNGNCINSIWWCDFDNDCGDMSDERNCPTTICDLDTQFRCQESGTCIPLSYKCDLEDDCGDNSDESHCEMHQCRSDEYNCSSGMCIRSSWVCDGDNDCRDWSDEANCTAIYHTCEASNFQCRNGHCIPQRWACDGDTDCQDGSDEDPVNCEKKCNGFRCPNGTCIPSSKHCDGLRDCSDGSDEQHCEPLCTHFMDFVCKNRQQCLFHSMVCDGIIQCRDGSDEDAAFAGCSQDPEFHKVCDEFGFQCQNGVCISLIWKCDGMDDCGDYSDEANCENPTEAPNCSRYFQFRCENGHCIPNRWKCDRENDCGDWSDEKDCGDSHILPFSTPGPSTCLPNYYRCSSGTCVMDTWVCDGYRDCADGSDEEACPLLANVTAASTPTQLGRCDRFEFECHQPKTCIPNWKRCDGHQDCQDGRDEANCPTHSTLTCMSREFQCEDGEACIVLSERCDGFLDCSDESDEKACSDELTVYKVQNLQWTADFSGDVTLTWMRPKKMPSASCVYNVYYRVVGESIWKTLETHSNKTNTVLKVLKPDTTYQVKVQVQCLSKAHNTNDFVTLRTPEGLPDAPRNLQLSLPREAEGVIVGHWAPPIHTHGLIREYIVEYSRSGSKMWASQRAASNFTEIKNLLVNTLYTVRVAAVTSRGIGNWSDSKSITTIKGKVIPPPDIHIDSYGENYLSFTLTMESDIKVNGYVVNLFWAFDTHKQERRTLNFRGSILSHKVGNLTAHTSYEISAWAKTDLGDSPLAFEHVMTRGVRPPAPSLKAKAINQTAVECTWTGPRNVVYGIFYATSFLDLYRNPKSLTTSLHNKTVIVSKDEQYLFLVRVVVPYQGPSSDYVVVKMIPDSRLPPRHLHVVHTGKTSVVIKWESPYDSPDQDLLYAVAVKDLIRKTDRSYKVKSRNSTVEYTLNKLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDALKIITENDHVLLFWKSLALKEKHFNESRGYEIHMFDSAMNITAYLGNTTDNFFKISNLKMGHNYTFTVQARCLFGNQICGEPAILLYDELGSGADASATQAARSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQSSFTAFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIAn |
