Details of PSQ01476
| ProSeqID |
PSQ01476 |
| Family |
FD00022 |
| Protein Name |
Rhesus theta defensin-1 |
| UniProt ID |
P82271
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Cercopithecidae-Cercopithecinae-Macaca |
| Organisms |
Macaca mulatta (Rhesus macaque) |
| Prosequence Length (aa) |
42 |
| Functions |
None |
| Preproprotein Length (aa) |
76 |
| Alt Name |
Demidefensin-1, RTD-2 |
| Gene Name |
RTD1B |
| NCBI ID |
9544 |
| Cellular Localization |
extracellular space |
| Processes |
antibacterial humoral response, antimicrobial humoral immune response mediated by antimicrobial peptide, cellular response to lipopolysaccharide, defense response to fungus, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, innate immune response in mucosa, killing of cells of other organism, membrane disruption in other organism |
| PubMed |
10521339
|
| Total Prosequence Length (aa) |
42 |
| Prosequence Location |
23:64 |
| Prosequence Sequence |
RQARADEAAAQQQPGADDQGMAHSFTRPENAALPLSESARGL |
| Preproprotein Sequence |
MRTFALLTAMLLLVALHAQAEARQARADEAAAQQQPGADDQGMAHSFTRPENAALPLSESARGLRCLCRRGVCQLL |