Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
Preproprotein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Download whole result Csv
Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions Preproprotein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ01551 FD00002 Raniseptin-6 P86039 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Hylinae Cophomantini Boana Hypsiboas raniceps (Chaco tree frog) (Hyla roeschmanni) 27 None 80 None None 192750 extracellular region defense response to bacterium 18976634 27 23:49 EEEKREGEEEEKQEEENEELSEEELRE
PSQ01552 FD00002 Raniseptin-7 P86040 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Hylinae Cophomantini Boana Hypsiboas raniceps (Chaco tree frog) (Hyla roeschmanni) 27 None 80 None None 192750 extracellular region defense response to bacterium 18976634 27 23:49 EEEKREGEEEEKQEEENEELSEEELRE
PSQ01553 FND00210 Lantibiotic epilancin 15X P86047 Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus epidermidis 24 signaling receptor binding 60 None elxA 1282 None cytolysis, defense response to bacterium 15792796, 21802007 24 1:24 MKKELFDLNLNKDIEAQKSDLNPQ
PSQ01554 FND00094 Ranakinin-N P86093 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Sylvirana Sylvirana nigrovittata (Black-striped frog) (Hylarana nigrovittata) 21 None 60 None None 127021 extracellular region defense response, positive regulation of muscle contraction, vasodilation 17994619 21 23:43 EEKRDADEEETEGEAKMEDIK
PSQ01555 FND00102 Potassium channel toxin kappa-KTx 2 P86110 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Scorpiones Iurida Scorpionoidea Hemiscorpiidae Opisthacanthus Opisthacanthus cayaporum (South American scorpion) 16 toxin activity 70 OcyC8 , OcyKTx6 None 573324 extracellular region None 18502464, 21624408 16 27:42 EPKDGEIAGFEMEEAR
PSQ01556 FND00198 Eumenine mastoparan-OD P86146 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Vespoidea Vespidae Eumeninae Orancistrocerus Orancistrocerus drewseni (Solitary wasp) 38 toxin activity 79 Venom peptide 1 VP1 529024 extracellular region defense response to fungus, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, hemolysis in other organism 18695936, 19857508 38 25:62 EPLPEAAPAPSPLAEAEALASPIAEALANPEALASPEA
PSQ01557 FND00323 Venom peptide 2-long P86147 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Vespoidea Vespidae Eumeninae Orancistrocerus Orancistrocerus drewseni (Solitary wasp) 30 toxin activity 71 None VP2 529024 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 19857508 30 25:54 VPAPVPEAAPGPVAEAEAYASPEALASPEA
PSQ01558 FND00069 Potassium channel toxin alpha-KTx 8 P86400 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Scorpiones Buthida Buthoidea Buthidae Mesobuthus Mesobuthus eupeus (Lesser Asian scorpion) (Buthus eupeus) 9 ion channel inhibitor activity, toxin activity 60 MeuTXKalpha1 , Toxin MeuKTx-1 , meuK-toxin , pMeKTx1-1 None 34648 extracellular region pathogenesis 20889474 9 20:28 IMPDMKVEA
PSQ01559 FND00180 Neuropeptide F P86442 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Polyneoptera Orthoptera Caelifera Acrididea Acridomorpha Acridoidea Acrididae Oedipodinae Locusta Locusta migratoria (Migratory locust) 24, 29 hormone activity 92 None None 7004 extracellular region neuropeptide signaling pathway 19456328;19456328 53 28:51, 64:92 QQADGNKLEGLADALKYLQELDRY, AELRPDVVDDVIPEEMSADKFWRRFARRR
PSQ01560 FD00038 Lantibiotic lichenicidin VK21 A1 P86475 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus licheniformis 42 signaling receptor binding 74 None lchA1 1402 extracellular space cytolysis, defense response to Gram-positive bacterium 20578714 42 1:42 MSKKEMILSWKNPMYRTESSYHPAGNILKELQEEEQHSIAGG
PSQ01561 FND00281 Lantibiotic lichenicidin VK21 A2 P86476 Bacteria Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus licheniformis 40 signaling receptor binding 72 None lchA2 1402 extracellular space cytolysis, defense response to Gram-positive bacterium 20578714 40 1:40 MKTMKNSAAREAFKGANHPAGMVSEEELKALVGGNDVNPE
PSQ01562 FND00075 Bombesin P86483 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Sanguirana Sanguirana varians (Palawan frog) (Rana varians) 19 None 67 None None 367680 extracellular region defense response, neuropeptide signaling pathway, positive regulation of muscle contraction 19857598 19 31:49 DFIQDAGKLERIDTYKREA
PSQ01563 FND00056 Spiderine-1a P86716 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Lycosoidea Oxyopidae Oxyopes Oxyopes takobius (Lynx spider) (Oxyopes foliiformis) 40 toxin activity 166 OtTx1a None 666126 extracellular region cytolysis, defense response to bacterium 24118933 40 19:58 TGDLETELEASELQELQEALDLIGETPLESLEAEELEEAR
PSQ01564 FND00056 Spiderine-2a P86718 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Lycosoidea Oxyopidae Oxyopes Oxyopes takobius (Lynx spider) (Oxyopes foliiformis) 40 toxin activity 178 OtTx2a None 666126 extracellular region cytolysis, defense response to bacterium 24118933 40 19:58 TGDLETELEASELQELQEALDLIAETPLESLEAEELEEAR
PSQ01565 FD00025 Cyclotide cter-A P86841 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Clitoria Clitoria ternatea (Butterfly pea) 65 None 124 None None 43366 None defense response 21596752 65 60:124 HIIAAEAKTMDEHILLCQSHEDCIAKGTGNFCAPFPDQDIKYGWCFRAESEGFMLKDHLKMSITN
PSQ01566 FD00025 Cyclotide cter-B P86842 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Clitoria Clitoria ternatea (Butterfly pea) 75 None 135 None None 43366 None defense response 21596752 75 61:135 HVIAFEAKTMDEHHLLCQSHEDCYKKGSGNFCAPFFNHDVKYGWCFRAEFEGYLLKDFLKMQPRDILKISKAIAK
PSQ01567 FD00119 Cyclotide cter-M P86899 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Clitoria Clitoria ternatea (Butterfly pea) 74 None 127 None None 43366 extracellular region defense response, hemolysis in other organism 21593408 74 54:127 HIIAANAKTVNEHRLLCTSHEDCFKKGTGNYCASFPDSNIHFGWCFHAESEGYLLKDFMNMSKDDLKMPLESTN
PSQ01568 FND00075 Bombesin P86994 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Ranoidea Ranidae Rana Rana Rana shuchinae (Sichuan frog) (Pelophylax shuchinae) 19 None 67 Bombesin-RS None 359668 extracellular region defense response, neuropeptide signaling pathway 21104135 19 31:49 DFLQEAGKLEGIETYKKEA
PSQ01569 FD00011 Alkaline protease 2 P87184 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Eurotiales Aspergillaceae Aspergillus Aspergillus subgen Fumigati Neosartorya fumigata (strain ATCC MYA-4609 , A1100) (Aspergillus fumigatus) 120 IgE binding, serine-type endopeptidase activity 495 Autophagic serine protease alp2 alp2 330879 extracellular space asexual sporulation resulting in formation of a cellular spore, pathogenesis 11251631 120 17:136 SPVVVDSIHNGAAPILSSMNAKEVPDSYIVVFKKHVNAESAAAHHSWVQDIHSAQNERVELRKRSLFGFGEEAYLGLKNTFDIAGSLVGYSGHFHEDVIEQVRKHPDVEYIEKDSEVHTM
PSQ01570 FD00031 Defensin-A P91793 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Nematocera Culicoidea Culicidae Culicinae Aedini Aedes Stegomyia Aedes aegypti (Yellowfever mosquito) (Culex aegypti) 40 None 98 AaDef DEFA 7159 extracellular region defense response to bacterium, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, innate immune response 7568275, 7633471 40 19:58 SAYPQEPVLADEARPFANSLFDELPEETYQAAVENFRLKR
PSQ01571 FND00037 FMRFamide-related neuropeptides P91889 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Cephalopoda Coleoidea Decapodiformes Sepiida Sepiina Sepiidae Sepia Sepia officinalis (Common cuttlefish) 40, 9, 66, 11, 12, 10, 8, 11, 11 None 331 None FMRFa 6610 extracellular region neuropeptide signaling pathway 11060217;11060217;11060217;11060217;11060217;11060217;11060217;11060217;11060217 178 26:65, 86:94, 103:168, 184:194, 225:236, 245:254, 286:293, 302:312, 321:331 FDLAQACVESQRLSLLPICDTIFAVQQEGAQQSADDGLRS, NVPDLPFED, AAPQLDDLLKQALQRVESLQKSDDTSVRRKRSTDAAPQSNTDSAEQKNDSAKITKRYVDDVEDSDV, NPSDVGSKLTE, NPGDAEDELEED, GDEEDEEEAE, NPEEPEAD, GGEEDDVNTEE, SAEKCKGCLEG
PSQ01572 FD00028 2S albumin seed storage protein P93198 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Fagales Juglandaceae Juglans Juglans regia (English walnut) 16, 14 nutrient reservoir activity 139 2S albumin , Allergen Jug r 1 None 51240 extraorganismal space seed maturation 11799381;11799381 30 16:31, 58:71 FRTTITTMEIDEDIDN, QQSRSGGYDEDNQR
PSQ01573 FD00488 Gingipain R2 P95493 Bacteria Bacteroidetes Bacteroidia Bacteroidales Porphyromonadaceae Porphyromonas Porphyromonas gingivalis (strain ATCC BAA-308 205 calcium ion binding, calcium-dependent cysteine-type endopeptidase activity 736 Arg-gingipain, Gingipain 2, RGP-2 rgpB 242619 extracellular region pathogenesis, proteolysis 9705298 205 25:229 QPAERGRNPQVRLLSAEQSMSKVQFRMDNLQFTGVQTSKGVAQVPTFTEGVNISEKGTPILPILSRSLAVSETRAMKVEVVSSKFIEKKDVLIAPSKGVISRAENPDQIPYVYGQSYNEDKFFPGEIATLSDPFILRDVRGQVVNFAPLQYNPVTKTLRIYTEIVVAVSETAEAGQNTISLVKNSTFTGFEDIYKSVFMNYEATR
PSQ01574 FD00075 Zona pellucida sperm-binding protein 3 P97708 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 73 acrosin binding, carbohydrate binding, receptor ligand activity, structural constituent of egg coat 424 Zona pellucida glycoprotein 3, Zona pellucida protein C Zp3 10116 collagen-containing extracellular matrix, egg coat, extracellular matrix, extracellular space, integral component of membrane, plasma membrane binding of sperm to zona pellucida, blastocyst formation, egg coat formation, humoral immune response mediated by circulating immunoglobulin, negative regulation of binding of sperm to zona pellucida, negative regulation of transcription, DNA-templated, oocyte development, phosphatidylinositol-mediated signaling, positive regulation of acrosomal vesicle exocytosis, positive regulation of acrosome reaction, positive regulation of antral ovarian follicle growth, positive regulation of humoral immune response, positive regulation of inflammatory response, positive regulation of interferon-gamma production, positive regulation of interleukin-4 production, positive regulation of leukocyte migration, positive regulation of ovarian follicle development, positive regulation of T cell proliferation, positive regulation of transcription, DNA-templated, positive regulation of type IV hypersensitivity, regulation of signaling receptor activity 16342937 73 352:424 RRHVTDEADVTVGPLIFLGKANDQAVEGWTSSAQTSVALGLGLATVAFLTLAAIVLGVTRKCHTSSYLVSLPQ
PSQ01575 FD00011 Subtilisin-like serine protease Pen ch 13 P9WEW3 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Eurotiales Aspergillaceae Penicillium Penicillium chrysogenum species complex Penicillium rubens 96 IgE binding, serine-type endopeptidase activity 398 Alkaline serine protease None 1108849 extracellular space proteolysis 10231324, 11893850, 12602675 96 20:115 GKLLTANDGDEVVPSSYIVVMNDGVSTAQFETHRNWAANVHARTRSLKGGESGPGKHFDINGMKGYSASFDDRTVKDIASDPTVKYVEPDMVVNAT
PSQ01576 FD00011 Subtilisin-like serine protease Pen ch 18 P9WEW5 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Eurotiales Aspergillaceae Penicillium Penicillium chrysogenum species complex Penicillium rubens 120 IgE binding, serine-type endopeptidase activity 494 Vacuolar serine protease None 1108849 None None 10231324 120 17:136 SPVAVNSIHNDAAPILSSMTSKDIPDSYIVVFKKHVDPSSASAHQSWLQEVHTAHTGRMELKKRSLFGFDFEAFMGLKHTFHIAGSLLGYAGHFHEDVIEQIRRHPDVDYIEKDSEVRTM
PSQ01577 FD00067 Proteasome subunit beta P9WHT9 Bacteria Actinobacteria Corynebacteriales Mycobacteriaceae Mycobacterium Mycobacterium tuberculosis complex Mycobacterium tuberculosis (strain ATCC 25618 57 threonine-type endopeptidase activity, zymogen binding 298 20S proteasome beta subunit , Proteasome core protein PrcB prcB 83332 cytoplasm, extracellular region, plasma membrane, proteasome core complex, alpha-subunit complex, proteasome core complex, beta-subunit complex mitigation of host defenses by symbiont, modification-dependent protein catabolic process, pathogenesis, proteasomal protein catabolic process, proteolysis involved in cellular protein catabolic process 16468985 57 1:57 MTWPLPDRLSINSLSGTPAVDLSSFTDFLRRQAPELLPASISGGAPLAGGDAQLPHG
PSQ01578 FND00353 Low molecular weight antigen MTB12 P9WIN7 Bacteria Actinobacteria Corynebacteriales Mycobacteriaceae Mycobacterium Mycobacterium tuberculosis complex Mycobacterium tuberculosis (strain ATCC 25618 26 None 168 CFP-2, Low molecular weight protein antigen 2 mtb12 83332 cell wall, extracellular region None 10812229, 9712769 26 23:48 GVTSIMAGGPVVYQMQPVVFGAPLPL
PSQ01579 FD00307 Type II secretion system core protein G Q00514 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas aeruginosa (strain ATCC 15692 , 14847 8 None 142 General secretion pathway protein G, PilD-dependent protein PddA xcpT 208964 integral component of membrane, plasma membrane, type II protein secretion system complex protein secretion by the type II secretion system 8331069 8 1:8 MQRRQQSG
PSQ01580 FD00326 Type II secretion system protein H Q00515 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas aeruginosa (strain ATCC 15692 , 14847 6 None 179 General secretion pathway protein H, PilD-dependent protein PddB xcpU 208964 integral component of membrane, plasma membrane, type II protein secretion system complex, type IV pilus bacterial-type flagellum-dependent swarming motility, protein secretion by the type II secretion system, single-species biofilm formation, type IV pilus biogenesis, type IV pilus-dependent motility 8331069 6 1:6 MRASRG
PSQ01581 FD00453 Type II secretion system protein I Q00516 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas aeruginosa (strain ATCC 15692 , 14847 6 None 129 General secretion pathway protein I, PilD-dependent protein PddC xcpV 208964 integral component of membrane, plasma membrane, type II protein secretion system complex protein secretion by the type II secretion system 8331069 6 1:6 MKRARG
PSQ01582 FD00458 Type II secretion system protein J Q00517 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas aeruginosa (strain ATCC 15692 , 14847 6 None 240 General secretion pathway protein J, PilD-dependent protein PddD xcpW 208964 integral component of membrane, plasma membrane, type II protein secretion system complex protein secretion by the type II secretion system 8331069 6 1:6 MRLQRG
PSQ01583 FD00196 Type II secretion system protein K Q00518 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas aeruginosa (strain ATCC 15692 , 14847 7 None 333 General secretion pathway protein K xcpX 208964 integral component of membrane, plasma membrane, type II protein secretion system complex protein secretion by the type II secretion system 9466253 7 1:7 MRRGQNG
PSQ01584 FD00024 Candidapepsin Q00663 Eukaryota Fungi Dikarya Ascomycota Saccharomycotina Saccharomycetes Saccharomycetales Debaryomycetaceae Candida/Lodderomyces clade Candida Candida tropicalis (Yeast) 37 aspartic-type endopeptidase activity 394 ACP, Aspartate protease, Secreted aspartic proteinase SAPT1 5482 extracellular region None 1864366 37 24:60 LTIPDGIEKRTDKVVSLDFTVIRKPFNATAHRLIQKR
PSQ01585 FD00007 Chymotrypsin BI Q00871 Eukaryota Metazoa Ecdysozoa Arthropoda Crustacea Multicrustacea Malacostraca Eumalacostraca Eucarida Decapoda Dendrobranchiata Penaeoidea Penaeidae Penaeus Penaeus vannamei (Whiteleg shrimp) (Litopenaeus vannamei) 30 serine-type endopeptidase activity 271 None None 6689 extracellular space collagen catabolic process 1458841 30 16:45 SGNPAAGKPWHWKSPKPLVDPRIHVNATPR
PSQ01586 FND00345 Internal virion protein gp7 Q01074 Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Podoviridae Lederbergvirus Salmonella phage P22 (Bacteriophage P22) 20 None 229 Ejection protein gp7 7 10754 virion viral genome ejection through host cell envelope, short tail mechanism 1853558 20 1:20 MLYAFTLGRKLRGEEPSYPE
PSQ01587 FD00435 Desmocollin-1 Q01107 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos Bos taurus (Bovine) 103 calcium ion binding 900 Desmosomal glycoprotein 2 DSC1 9913 desmosome, integral component of membrane, plasma membrane calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules, homophilic cell adhesion via plasma membrane adhesion molecules 2277091 103 30:132 CQKISLQVPSHLRAEALVGKVNLKECLQSASLILSSDPDFRILEDGSIYTTHDLVLSSGKSFSILLSDSQGQGQKEIEIILEAGGKKVPKRHMKDAVLRRTKR
PSQ01588 FD00313 Decorin Q01129 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) 14 collagen binding, extracellular matrix binding, extracellular matrix structural constituent conferring compression resistance, glycosaminoglycan binding, protein N-terminus binding 360 Bone proteoglycan II, Dermatan sulfate proteoglycan-II, PG-S2, PG40 Dcn 10116 collagen type VI trimer, extracellular matrix, extracellular space aging, kidney development, negative regulation of angiogenesis, negative regulation of endothelial cell migration, negative regulation of vascular endothelial growth factor signaling pathway, peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan, placenta development, positive regulation of autophagy, positive regulation of macroautophagy, positive regulation of mitochondrial depolarization, positive regulation of mitochondrial fission, positive regulation of phosphatidylinositol 3-kinase signaling, positive regulation of transcription by RNA polymerase II, response to lipopolysaccharide, response to mechanical stimulus, skeletal muscle tissue development, wound healing 26479776, 2764879 14 17:30 GPFEQRGLFDFMLE
PSQ01589 FND00230 Major microfilarial sheath protein Q01493 Eukaryota Metazoa Ecdysozoa Nematoda Chromadorea Rhabditida Spirurina Spiruromorpha Filarioidea Onchocercidae Litomosoides Litomosoides carinii 25 None 148 None GP22 6299 None None 1780176 25 19:43 LYFGSHRPQYLREVGQRQYPFEPQA
PSQ01590 FD00215 Alliin lyase 1 Q01594 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida Liliopsida Asparagales Amaryllidaceae Allioideae Allieae Allium Allium sativum (Garlic) 10 alliin lyase activity, chloride ion binding, protein homodimerization activity, pyridoxal phosphate binding 486 Cysteine sulphoxide lyase 1 None 4682 vacuole None 1385120 10 29:38 LVNNNNMVQA
PSQ01591 FD00473 Methionine aminopeptidase 1 Q01662 Eukaryota Fungi Dikarya Ascomycota Saccharomycotina Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (strain ATCC 204508 9 metal ion binding, metalloaminopeptidase activity, mRNA binding 387 Peptidase M 1 MAP1 559292 cytoplasmic stress granule, cytosolic ribosome negative regulation of gene expression, protein initiator methionine removal involved in protein maturation 1569059 9 2:10 STATTTVTT
PSQ01592 FD00441 Bacterial leucyl aminopeptidase Q01693 Bacteria Proteobacteria Gammaproteobacteria Vibrionales Vibrionaceae Vibrio Vibrio proteolyticus (Aeromonas proteolytica) 85, 99 aminopeptidase activity, metal ion binding 504 None None 671 extracellular region None 1569090, 1627651,;1627651 184 22:106, 406:504 EDKVWISIGADANQTVMKSGAESILPNSVASSGQVWVGQVDVAQLAELSHNMHEEHNRCGGYMVHPSAQSAMAASAMPTTLASFV, LEDGVPVTDLSGSRGSNVWYTFELETQKNLQITTSGGYGDLDLYVKFGSKASKQNWDCRPYLSGNNEVCTFNNASPGTYSVMLTGYSNYSGASLKASTF
PSQ01593 FD00012 Cysteine proteinase 1 Q01957 Eukaryota Amoebozoa Evosea Archamoebae Mastigamoebida Entamoebidae Entamoeba Entamoeba histolytica 80 cysteine-type peptidase activity 315 None CPP1 5759 None None 2557443 80 14:93 IDFNTWVANNNKHFTAVESLRRRAIFNMNARIVAENNRKETFKLSVDGPFAAMTNEEYNSLLKLKRSGEEKGEVRYLNIQ
PSQ01594 FD00030 Penicillopepsin-1 Q01972 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Eurotiales Aspergillaceae Penicillium Penicillium roqueforti 51 aspartic-type endopeptidase activity 397 Acid protease , Aspartic protease aspA aspA 5082 extracellular region response to ammonium ion, response to pH 9413440 51 21:71 AAVRQEPPQGFTVNQVQKAVPGTRTVNLPGLYANALVKYGATVPATVHAAA
PSQ01595 FD00155 Pro-neuregulin-1 Q02297 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 19 chemorepellent activity, cytokine activity, ErbB-3 class receptor binding, growth factor activity, integrin binding, protein tyrosine kinase activator activity, receptor tyrosine kinase binding, signaling receptor binding, transcription coregulator activity, transmembrane receptor protein tyrosine kinase activator activity 640 None NRG1 9606 apical plasma membrane, extracellular region, extracellular space, glutamatergic synapse, integral component of membrane, integral component of postsynaptic density membrane, integral component of presynaptic active zone membrane, membrane, nucleoplasm, plasma membrane activation of MAPK activity, activation of protein kinase B activity, activation of transmembrane receptor protein tyrosine kinase activity, animal organ development, cardiac muscle cell differentiation, cardiac muscle cell myoblast differentiation, cell communication, cell differentiation, cell population proliferation, cellular protein complex disassembly, endocardial cell differentiation, ERBB signaling pathway, ERBB2 signaling pathway, ERBB3 signaling pathway, ERBB4 signaling pathway, intracellular signal transduction, mammary gland development, MAPK cascade, negative regulation of cardiac muscle cell apoptotic process, negative regulation of extrinsic apoptotic signaling pathway in absence of ligand, negative regulation of secretion, negative regulation of transcription, DNA-templated, nervous system development, neural crest cell development, positive regulation of cardiac muscle cell proliferation, positive regulation of cell adhesion, positive regulation of cell growth, positive regulation of cell population proliferation, positive regulation of peptidyl-tyrosine autophosphorylation, positive regulation of protein kinase B signaling, positive regulation of protein-containing complex assembly, positive regulation of striated muscle cell differentiation, regulation of cell motility, regulation of postsynaptic neurotransmitter receptor internalization, synaptic membrane adhesion, transmembrane receptor protein tyrosine kinase signaling pathway, ventricular cardiac muscle cell differentiation, ventricular trabecula myocardium morphogenesis, wound healing 7689552 19 1:19 MSERKEGRGKGKGKKKERG
PSQ01596 FD00391 Epsilon-toxin type B Q02307 Bacteria Firmicutes Clostridia Clostridiales Clostridiaceae Clostridium Clostridium perfringens 13 toxin activity 328 None etxB 1502 None pathogenesis 1729175 13 33:45 KEISNTVSNEMSK
PSQ01597 FD00282 Alpha-latroinsectotoxin-Lt1a Q02989 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Araneoidea Theridiidae Latrodectus Latrodectus tredecimguttatus (Mediterranean black widow spider), (Latrodectus mactans tredecimguttatus) 35 toxin activity 1411 Alpha-latroinsectotoxin None 6925 extracellular region, integral component of membrane, other organism cell membrane exocytosis 8477689 35 1:35 ACSSPEVSIFHFFVYAGSFVKNFKKMKGSSAISKR
PSQ01598 FD00485 Lysosomal aspartic protease Q03168 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Nematocera Culicoidea Culicidae Culicinae Aedini Aedes Stegomyia Aedes aegypti (Yellowfever mosquito) (Culex aegypti) 35 aspartic-type endopeptidase activity 387 None None 7159 lysosome None 1400492 35 19:53 DFVRVQLHKTESARQHFRNVDTEIKQLRLKYNAVS
PSQ01599 FND00128 Cell wall mannoprotein PIR1 Q03178 Eukaryota Fungi Dikarya Ascomycota Saccharomycotina Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (strain ATCC 204508 45 structural constituent of cell wall 341 Covalently-linked cell wall protein 6, Protein with internal repeats 1 PIR1 559292 cellular bud scar, extracellular region, fungal-type cell wall, nuclear periphery fungal-type cell wall organization, intracellular protein transport 9301021 45 19:63 AYAPKDPWSTLTPSATYKGGITDYSSTFGIAVEPIATTASSKAKR
PSQ01600 FND00285 Cell wall mannoprotein PIR3 Q03180 Eukaryota Fungi Dikarya Ascomycota Saccharomycotina Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (strain ATCC 204508 49 structural constituent of cell wall 325 Covalently-linked cell wall protein 8, Protein with internal repeats 3 PIR3 559292 extracellular region, fungal-type cell wall fungal-type cell wall organization 8314797 49 19:67 AYAPKDPWSTLTPSATYKGGITDYSSSFGIAIEAVATSASSVASSKAKR
Total Pages 43
Go to Lab Web Page