Proseq ID | Family | Protein Name ![]() |
Uniprot ID | Taxonomy | Organism | Prosequence length![]() |
Functions | Preproprotein length | Alter Name | Gene Name | NCBI ID | Cell Org | Process | PubMed | Total Proseq length | Proseq Loc | Prosequence Sequence | |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
PSQ01501 | FD00002 | Tryptophyllin-1 | P83455 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Agalychnis | Agalychnis dacnicolor (Giant mexican leaf frog) (Pachymedusa dacnicolor) | 31 | None | 62 | PdT-1 | None | 75988 | extracellular region | defense response | 14687697 | 31 | 23:53 | DEEKRQDDDEGNEREEKKEIQEDGNQEERRD | |
PSQ01502 | FD00043 | Pregnancy-associated glycoprotein 6 | P83493 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Caprinae Ovis | Ovis aries (Sheep) | 38 | aspartic-type endopeptidase activity | 380 | Pregnancy-associated glycoprotein 58a | None | 9940 | extracellular space | None | 15460157 | 38 | 16:53 | IVKIPLRRVKTMRKTLSEKNMLNNFLKEHAYRLSQISF | |
PSQ01503 | FD00043 | Pregnancy-associated glycoprotein 4 | P83495 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Caprinae Ovis | Ovis aries (Sheep) | 38 | aspartic-type endopeptidase activity | 380 | Pregnancy-associated glycoprotein 58c | None | 9940 | extracellular space | None | 15460157 | 38 | 16:53 | IFKIPLRRVKTMRKTLSGKNMLNDVLKEHPYRLPQISF | |
PSQ01504 | FD00058 | Snake venom metalloproteinase BaP1 | P83512 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Bothrops | Bothrops asper (Terciopelo) | 171 | metal ion binding, metalloendopeptidase activity, toxin activity | 408 | Hemorrhagic metalloproteinase BaP1 | None | 8722 | extracellular region | chemotaxis | 14500885 | 171 | 21:191 | IILESGNVNDYEVVYPRKVTELPKGAVQPKYEDAMQYEFKVNGEPVVLHLEKNKGLFSEDYSETHYSPDGRKIITYPSFEDHCYYHGRIENDADSTASISACNGLKGHFKLQGETYLIEPLKLSDSEAHAVYKYENVEKEDEAPKMCGVTETNWESYEPIKKASQSNLTPE | |
PSQ01505 | FD00367 | Transglutaminase-activating metalloprotease | P83543 | Bacteria Actinobacteria Streptomycetales Streptomycetaceae Streptomyces | Streptomyces mobaraensis (Streptoverticillium mobaraense) | 196 | calcium ion binding, metalloendopeptidase activity, serine-type endopeptidase activity | 760 | Transglutaminase-activating metalloproteinase | None | 35621 | extracellular region, membrane | None | 12869197 | 196 | 34:229 | GQDKAAHPAPRQSIHKPDPGAEPVKLTPSQRAELIRDANATKAETAKNLGLGAKEKLVVKDVVKDKNGTLHTRYERTYDGLPVLGGDLVVDATRSGQVKTAAKATKQRIAVASTTPSLAASAAEKDAVKAARAKGSKAGKADKAPRKVVWAAKGTPVLAYETVVGGVQDDGTPSQLHVITDAKTGKKLFEFQGVKQ | |
PSQ01506 | FD00246 | Mu-hexatoxin-Mg1a | P83558 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Hexathelidae Macrothele | Macrothele gigas (Japanese funnel web spider) | 60 | sodium channel inhibitor activity, toxin activity | 121 | Neurotoxin magi-2 | None | 223896 | extracellular region | None | 12860384 | 60 | 21:80 | SEGEVKNEFEERLKDEFKDPSRSEVAEVILLRELEVLEETLFGKEMTSDTEENRNSREKR | |
PSQ01507 | FD00177 | Beta-hexatoxin-Mg1a | P83561 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Hexathelidae Macrothele | Macrothele gigas (Japanese funnel web spider) | 30 | sodium channel inhibitor activity, toxin activity | 79 | Neurotoxin magi-5 | None | 223896 | extracellular region | pathogenesis | 12860384, 17148449 | 30 | 21:50 | TPDLEEGDLLAELGDLIATDDEYPMKPEER | |
PSQ01508 | FND00034 | U7-hexatoxin-Mg1a | P83562 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Hexathelidae Macrothele | Macrothele gigas (Japanese funnel web spider) | 18 | toxin activity | 82 | Neurotoxin magi-6 | None | 223896 | extracellular region | None | 12860384 | 18 | 27:44 | ASHELQEYPIEESLEEQR | |
PSQ01509 | FD00291 | Omega-hexatoxin-Ar1a | P83580 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Hexathelidae Atrax | Atrax robustus (Sydney funnel-web spider) | 26 | calcium channel inhibitor activity, toxin activity | 85 | Omega-atracotoxin-Ar1a | None | 6903 | extracellular region | defense response, pathogenesis | 17610847 | 26 | 23:48 | EDAVPDFEGGFASHAREDTVGGKIRR | |
PSQ01510 | FD00077 | Prolyl tri | P83615 | Bacteria Actinobacteria Streptomycetales Streptomycetaceae Streptomyces | Streptomyces mobaraensis (Streptoverticillium mobaraense) | 6 | aminopeptidase activity | 480 | Tripeptidyl aminopeptidase | ptp | 35621 | cell surface, extracellular region | None | 14519127, 15598885 | 6 | 28:33 | ASITAP | |
PSQ01511 | FD00004 | Serine protease 30 | P83748 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Rattus | Rattus norvegicus (Rat) | 9 | serine-type endopeptidase activity, sodium channel regulator activity | 304 | Distal intestinal serine protease, Transmembrane serine protease 1, Transmembrane serine protease 8 | Prss30 | 10116 | anchored component of plasma membrane, extracellular space | proteolysis, sodium ion transport | 14669991 | 9 | 22:30 | DILHSGAGK | |
PSQ01512 | FD00044 | Neurotoxic enhancer CSTX-13 | P83919 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Lycosoidea Ctenidae Cupiennius | Cupiennius salei (American wandering spider) | 27, 6 | toxin activity | 120 | U2-ctenitoxin-Cs1a | None | 6928 | extracellular region | None | 15272079;15272079 | 33 | 21:47, 82:87 | ETDEDFFGEESFEADDIIPFIAKEQVR, RSETAR | |
PSQ01513 | FD00163 | Pectinesterase | P83947 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids fabids Rosales Moraceae Ficus | Ficus pumila var | 191 | aspartyl esterase activity, enzyme inhibitor activity, pectinesterase activity | 545 | None | None | 204231 | cell wall, extracellular region | cell wall modification, pectin catabolic process | 10898664, 16667199 | 191 | 38:228 | SPELSLHHKICDQSVNKESCLAMISEVTGLNMADHRNLLKSFLEKTTPRIQKAFETANDASRRINNPQERTALLDCAELMDLSKERVVDSISILFHQNLTTRSHEDLHVWLSGVLTNHVTCLDGLEEGSTDYIKTLMESHLNELILRARTSLAIFVTLFPAKSNVIEPVTGNFPTWVTAGDRRLLQTLGKD | |
PSQ01514 | FND00026 | Delta-theraphotoxin-Cg1a 1 | P83974 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Mygalomorphae Theraphosidae Chilobrachys | Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys, jingzhao) | 8 | ion channel inhibitor activity, toxin activity | 62 | Jingzhaotoxin-1 , Jingzhaotoxin-I , Peptide F5-24 | None | 278060 | extracellular region, host cell postsynaptic membrane | pathogenesis | 15548530, 17476710 | 8 | 22:29 | TEIEETDR | |
PSQ01515 | FD00042 | Osteocalcin | P84348 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Pan | Pan troglodytes (Chimpanzee) | 28 | calcium ion binding, hydroxyapatite binding, structural constituent of bone | 100 | Bone Gla protein, Gamma-carboxyglutamic acid-containing protein | BGLAP | 9598 | cytoplasm, extracellular region | biomineral tissue development, bone development, osteoblast differentiation, regulation of bone mineralization, regulation of cellular response to insulin stimulus, response to vitamin K | 15753298 | 28 | 24:51 | KPSGAESSKGAAFVSKQEGSEVVKRPRR | |
PSQ01516 | FD00042 | Osteocalcin | P84349 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Gorilla | Gorilla gorilla gorilla (Western lowland gorilla) | 28 | calcium ion binding, hydroxyapatite binding, structural constituent of bone | 100 | Bone Gla protein, Gamma-carboxyglutamic acid-containing protein | BGLAP | 9595 | cytoplasm, extracellular region | biomineral tissue development, bone development, osteoblast differentiation, regulation of bone mineralization, regulation of cellular response to insulin stimulus, response to vitamin D, response to vitamin K | 15753298 | 28 | 24:51 | KPSGAESSKGAAFVSKQEGSEVVKRPRR | |
PSQ01517 | FD00042 | Osteocalcin | P84350 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Pongo | Pongo pygmaeus (Bornean orangutan) | 28 | calcium ion binding | 100 | Bone Gla protein, Gamma-carboxyglutamic acid-containing protein | BGLAP | 9600 | cytoplasm, extracellular region | biomineral tissue development, bone development, regulation of bone mineralization, regulation of cellular response to insulin stimulus, response to vitamin K | 15753298 | 28 | 24:51 | KPSGADSSKGAAFVSKQEGSEVVKRPRR | |
PSQ01518 | FD00002 | Phylloseptin-H2 | P84567 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Pithecopus | Pithecopus hypochondrialis (Orange-legged leaf frog) (Phyllomedusa, hypochondrialis) | 22 | None | 66 | Phylloseptin-2 | psn2 | 317381 | extracellular region | defense response to bacterium | 15752569, 16713656 | 22 | 23:44 | EEEKRETEEEEYNQEEDDKSEE | |
PSQ01519 | FND00005 | Phylloseptin-H5 | P84572 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Pithecopus | Pithecopus hypochondrialis (Orange-legged leaf frog) (Phyllomedusa, hypochondrialis) | 22 | None | 66 | Phylloseptin-7 | psn7 | 317381 | extracellular region | defense response to bacterium | 16713656, 16963159 | 22 | 23:44 | EEEKRETEEEENEQEDDDKSEE | |
PSQ01520 | FD00002 | Dermaseptin-H3 | P84596 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Pithecopus | Pithecopus hypochondrialis (Orange-legged leaf frog) (Phyllomedusa, hypochondrialis) | 21 | None | 70 | DShypo 01 , Dermaseptin DPh-1 | None | 317381 | extracellular region | defense response to bacterium | 16844081 | 21 | 23:43 | EEEKRENEDEELQEDDEQSEM | |
PSQ01521 | FD00002 | Dermaseptin-H1 | P84597 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Pithecopus | Pithecopus hypochondrialis (Orange-legged leaf frog) (Phyllomedusa, hypochondrialis) | 23 | None | 76 | DShypo 02 , Dermaseptin-H4 | None | 317381 | extracellular region | defense response | 16844081 | 23 | 23:45 | EEEKRENEDEEEQEDDEQSEEKR | |
PSQ01522 | FD00037 | C-type natriuretic peptide | P84715 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Monotremata Ornithorhynchidae Ornithorhynchus | Ornithorhynchus anatinus (Duckbill platypus) | 22 | hormone activity, hormone receptor binding, potassium channel activity, sodium channel activity, toxin activity | 121 | None | None | 9258 | extracellular region | cGMP biosynthetic process, envenomation resulting in induction of edema in other organism, positive regulation of mast cell degranulation in other organism, positive regulation of relaxation of uterine smooth muscle in other organism, receptor guanylyl cyclase signaling pathway, regulation of blood pressure, vasodilation | 19928958 | 22 | 23:44 | KPPSPQPQVPRSPGDEASEAVA | |
PSQ01523 | FD00117 | Cysteine-rich venom protein kaouthin-2 | P84808 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Elapidae Elapinae Naja | Naja kaouthia (Monocled cobra) (Naja siamensis) | 6 | toxin activity | 240 | Cysteine-rich venom protein 23 | None | 8649 | extracellular region | defense response | 15670767, 19106157 | 6 | 20:25 | TVDFAS | |
PSQ01524 | FND00010 | [Val1,Thr6]-bradykinyl-Gln,Ser | P84899 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Pithecopus | Pithecopus hypochondrialis (Orange-legged leaf frog) (Phyllomedusa, hypochondrialis) | 28 | toxin activity | 61 | Bradykinin-related peptide VS-11 | None | 317381 | extracellular region | defense response | 16797783, 24394432 | 28 | 23:50 | EEEKREAEEEENEDEIEEQSEEKKRFEP | |
PSQ01525 | FD00006 | Alpha-conotoxin RegIIA | P85013 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Stephanoconus | Conus regius (Crown cone) | 28 | acetylcholine receptor inhibitor activity, toxin activity | 66 | Reg2a | None | 101314 | extracellular region, host cell postsynaptic membrane | pathogenesis | 17153339 | 28 | 22:49 | STSVRASDGRNAAADNRASDLIAQIVRR | |
PSQ01526 | FND00336 | Conotoxin Reg3b | P85021 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Stephanoconus | Conus regius (Crown cone) | 32 | toxin activity | 58 | Reg12c , Reg12i , Reg3 | None | 101314 | extracellular region | None | 17153339, 29283511 | 32 | 5:36 | PLDGDQPADQPAERMEDGESTPNHPWFDPVKR | |
PSQ01527 | FND00114 | Omega-lycotoxin-Gsp2671a | P85079 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Lycosoidea Lycosidae Alopecosa | Alopecosa marikovskyi (Wolf spider) (Lycosa kazakhstanicus) | 23 | toxin activity | 87 | Lsp-1, Omega-Lsp-IA | None | 2066572 | extracellular region | None | 17888477 | 23 | 18:40 | QPEFLDDEEDEVEETLPVAEEGR | |
PSQ01528 | FND00098 | Putative major capsid protein | P85226 | Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Herelleviridae Brockvirinae Kochikohdavirus Enterococcus virus EF24C | Enterococcus phage phiEF24C (Enterococcus bacteriophage phi-EF24C) | 20 | None | 464 | None | None | 442493 | host cell membrane, integral component of membrane, virion | None | 18096017 | 20 | 1:20 | MTEKKNTERQLTSVQEEVIK | |
PSQ01529 | FND00007 | M-zodatoxin-Lt8h | P85247 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Zodariidae Lachesana | Lachesana tarabaevi (Spider) | 40 | toxin activity | 129 | Cytoinsectotoxin-1h | cit 1-11 | 379576 | extracellular region | cytolysis by host of symbiont cells, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, hemolysis in other organism | 18215128 | 40 | 21:60 | KPAESEHELAEVEEENELADLEDAVWLEDLADLSDLEETR | |
PSQ01530 | FND00007 | M-zodatoxin-Lt8a | P85253 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Zodariidae Lachesana | Lachesana tarabaevi (Spider) | 40 | toxin activity | 129 | Cytoinsectotoxin-1a | cit 1-1 | 379576 | extracellular region | cytolysis by host of symbiont cells, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, hemolysis in other organism | 18215128 | 40 | 21:60 | KPAESEHELAEVEEENELADLEDAVWLEHLADLSDLEEAR | |
PSQ01531 | FND00007 | M-zodatoxin-Lt8b | P85254 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Zodariidae Lachesana | Lachesana tarabaevi (Spider) | 40 | toxin activity | 129 | Cytoinsectotoxin-1b | cit 1-2 | 379576 | extracellular region | defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, hemolysis in other organism | 18215128 | 40 | 21:60 | KPAESEHELAEVEEENELADLEDAVWLEHLADLSDLEEAR | |
PSQ01532 | FND00007 | M-zodatoxin-Lt8c | P85255 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Zodariidae Lachesana | Lachesana tarabaevi (Spider) | 40 | toxin activity | 129 | Cytoinsectotoxin-1c | cit 1-3 | 379576 | extracellular region | defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, hemolysis in other organism | 18215128 | 40 | 21:60 | KPAESEHELAEVEEENELADLEDAVWLEHLADLSDLEEAR | |
PSQ01533 | FND00007 | M-zodatoxin-Lt8d | P85256 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Zodariidae Lachesana | Lachesana tarabaevi (Spider) | 40 | toxin activity | 129 | Cytoinsectotoxin-1d | cit 1-4 | 379576 | extracellular region | defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, hemolysis in other organism | 18215128 | 40 | 21:60 | KPAESEHELAEVEEENELADLEDAVWLEHLADLSDLEEAR | |
PSQ01534 | FND00007 | M-zodatoxin-Lt8e | P85257 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Zodariidae Lachesana | Lachesana tarabaevi (Spider) | 40 | toxin activity | 129 | Cytoinsectotoxin-1e | cit 1-5 | 379576 | extracellular region | defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, hemolysis in other organism | 18215128 | 40 | 21:60 | KPAESEHELAEVEEENELADLEDAVWLEHLADLSDLEEAR | |
PSQ01535 | FND00007 | M-zodatoxin-Lt8f | P85258 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Zodariidae Lachesana | Lachesana tarabaevi (Spider) | 40 | toxin activity | 129 | Cytoinsectotoxin-1f | cit 1-7 | 379576 | extracellular region | cytolysis by host of symbiont cells, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, hemolysis in other organism | 18215128 | 40 | 21:60 | KPAESEHELAEVEEENELADLEDAVWLEHLADLSDLEEAR | |
PSQ01536 | FND00007 | M-zodatoxin-Lt8g | P85259 | Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Zodariidae Lachesana | Lachesana tarabaevi (Spider) | 40 | toxin activity | 129 | Cytoinsectotoxin-1g | cit 1-8 | 379576 | extracellular region | cytolysis by host of symbiont cells, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, hemolysis in other organism | 18215128 | 40 | 21:60 | KPAESEHELAEVEEENELADLEDAVWLEHLADLSDLEEAR | |
PSQ01537 | FND00159 | Myosuppressin | P85527 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Apoidea Apidae Apis | Apis mellifera (Honeybee) | 52 | None | 86 | None | None | 7460 | extracellular region | neuropeptide signaling pathway | 17068263 | 52 | 19:70 | GFLDDLPPRIRKVCVALSRIYELGSEMESYIGDKENHITGFHESIPLLDSGV | |
PSQ01538 | FND00142 | Allatostatins | P85797 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Apoidea Apidae Apis | Apis mellifera (Honeybee) | 29, 7, 10 | None | 197 | None | None | 7460 | extracellular region | neuropeptide signaling pathway | 17068263;17068263;17068263 | 46 | 28:56, 80:86, 188:197 | MEETPASSMNLQHYNNMLNPMVFDDTMPE, WIDTNDN, MSEDEEESSQ | |
PSQ01539 | FND00063 | Prohormone-1 | P85798 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Apoidea Apidae Apis | Apis mellifera (Honeybee) | 36 | None | 91 | None | None | 7460 | extracellular region | None | 17068263 | 36 | 24:59 | IPAADKERLLNEVDLVDDDGSIETALINYLFTKQIV | |
PSQ01540 | FND00227 | Prohormone-2 | P85799 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Apoidea Apidae Apis | Apis mellifera (Honeybee) | 156, 128 | None | 358 | None | None | 7460 | extracellular region | None | 17068263;17068263 | 284 | 22:177, 192:319 | LPTNLAEDTKKTEQTMRPKSKRAQEMLMFGNQQNHQPENNPSSSYSSTAEKRTLAASGLGGLKAALIEEEKPSRSNTLNNAFYDRKNYDYGAVNELGYEIPQVWDNSPYSRYYTNEDRRKRSEKSAVASGSSTTIKPSTTSFQSPTSTQQSVQTQV, ELDIDPEDVLTLLSLWENERRKRNWHKYMNEEYENVDDEDNLLEEEDSRNIIPWMDSSVYPPRHYSLDSLSPSDIGIIRTHPSSYYEQYENQYGQQYDTSQYGSPQYGLVYPQQTYYSAPEKRFMISR | |
PSQ01541 | FND00116 | Orcokinin peptides | P85832 | Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Apoidea Apidae Apis | Apis mellifera (Honeybee) | 62 | None | 147 | None | None | 7460 | extracellular region | neuropeptide signaling pathway | 17068263 | 62 | 28:89 | ETNLLRREFYGPVNPELFAAFLDDHDARGRENQRDFSSGSGTNELVDELSPVSERETLERFG | |
PSQ01542 | FD00002 | Phylloseptin-Az1 | P85881 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Pithecopus | Pithecopus azureus (Orange-legged monkey tree frog) (Phyllomedusa azurea) | 22 | None | 63 | Phylloseptin-2 | None | 2034991 | extracellular region | defense response to bacterium | 17553595 | 22 | 20:41 | EEEKRETEEEEYNQGEDDKSEE | |
PSQ01543 | FND00005 | Phylloseptin-Az2 | P85882 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Pithecopus | Pithecopus azureus (Orange-legged monkey tree frog) (Phyllomedusa azurea) | 22 | None | 66 | Phylloseptin-7 | None | 2034991 | extracellular region | defense response to bacterium | 17553595 | 22 | 23:44 | EEEKRETEEKENEQEDDDKSEE | |
PSQ01544 | FND00005 | Phylloseptin-Az3 | P85883 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Pithecopus | Pithecopus azureus (Orange-legged monkey tree frog) (Phyllomedusa azurea) | 22 | None | 66 | Phylloseptin-8 | None | 2034991 | extracellular region | defense response to bacterium | 17553595 | 22 | 23:44 | EEEKRETEEEEYNQEDDDKSEE | |
PSQ01545 | FD00006 | Alpha-conotoxin SrIA | P85886 | Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Lindaconus | Conus spurius (Alphabet cone) | 27 | acetylcholine receptor inhibitor activity, toxin activity | 69 | None | None | 192919 | extracellular region, host cell postsynaptic membrane | modulation of receptor activity in other organism, pathogenesis | 17635581 | 27 | 22:48 | FTSDSAFDSRNVAANDKVSDMIALTAR | |
PSQ01546 | FD00560 | Antimicrobial peptide 1b | P85966 | Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida Liliopsida Poales Poaceae BOP clade Pooideae Triticodae Triticeae Triticinae Triticum | Triticum kiharae (Wheat) | 37 | chitin binding | 120 | Antimicrobial peptide H1 | None | 376535 | None | defense response to bacterium, defense response to fungus, killing of cells of other organism | 19583772 | 37 | 80:116 | DDVVGQALPAEPGSTRATAASSASARGLNLTATTGGP | |
PSQ01547 | FD00413 | Major capsid protein | P85989 | Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Myoviridae | Serratia phage KSP90 (Serratia marcescens bacteriophage KSP90) | 51 | None | 441 | Virion protein D | None | 552528 | viral capsid | None | 19087204 | 51 | 1:51 | MSKKLVTEEMRTQWLPVLEKKSEQIQPLTAENVSVRLLQNQAEWNAKNLGE | |
PSQ01548 | FD00439 | Major capsid protein | P85990 | Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Myoviridae Peduovirinae Peduovirus unclassified Peduovirus | Serratia phage KSP20 (Serratia marcescens bacteriophage KSP20) | 31 | None | 348 | Major capsid protein B , Major head protein | None | 552527 | viral capsid | None | 19087204 | 31 | 1:31 | MENITRELFDQYISRQAQLNRVSPAAVAAKF | |
PSQ01549 | FD00002 | Raniseptin-1 | P86037 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Hylinae Cophomantini Boana | Hypsiboas raniceps (Chaco tree frog) (Hyla roeschmanni) | 27 | None | 80 | None | None | 192750 | extracellular region | defense response to bacterium | 18976634 | 27 | 23:49 | EEEKREGEEEEKQEEENEELSEEELRE | |
PSQ01550 | FD00002 | Raniseptin-3 | P86038 | Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Hylinae Cophomantini Boana | Hypsiboas raniceps (Chaco tree frog) (Hyla roeschmanni) | 27 | None | 79 | None | None | 192750 | extracellular region | defense response to bacterium | 18976634 | 27 | 23:49 | EEEKREGEEEEKQEEENEELSEEELRE |