Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01485

ProSeqID PSQ01485
Family FND00157
Protein Name Daisho1
UniProt ID P82705
Taxonomy Eukaryota-Metazoa-Ecdysozoa-Arthropoda-Hexapoda-Insecta-Pterygota-Neoptera-Holometabola-Diptera-Brachycera-Muscomorpha-Ephydroidea-Drosophilidae-Drosophila-Sophophora
Organisms Drosophila melanogaster (Fruit fly)
Prosequence Length (aa) 6
Functions None
Preproprotein Length (aa) 42
Alt Name Immune-induced peptide 4
Gene Name Dso1
NCBI ID 7227
Cellular Localization extracellular region, extracellular space
Processes cell morphogenesis, defense response, humoral immune response, innate immune response, positive regulation of antifungal innate immune response, response to bacterium, Toll signaling pathway
PubMed 12171930, 9736738
Total Prosequence Length (aa) 6
Prosequence Location 21:26
Prosequence Sequence EPVPQP
Preproprotein Sequence MKFFQAAALLLAMFAALANAEPVPQPGTVLIQTDNTQYIRTG