Details of PSQ01488
| ProSeqID |
PSQ01488 |
| Family |
FND00003 |
| Protein Name |
U1-theraphotoxin-Hs1a |
| UniProt ID |
P82959
|
| Taxonomy |
Eukaryota-Metazoa-Ecdysozoa-Arthropoda-Chelicerata-Arachnida-Araneae-Mygalomorphae-Theraphosidae-Haplopelma |
| Organisms |
Cyriopagopus schmidti (Chinese bird spider) (Haplopelma schmidti) |
| Prosequence Length (aa) |
26 |
| Functions |
toxin activity |
| Preproprotein Length (aa) |
85 |
| Alt Name |
Huwentoxin-2 form 1, Huwentoxin-II |
| Gene Name |
None |
| NCBI ID |
29017 |
| Cellular Localization |
extracellular region, host cell postsynaptic membrane |
| Processes |
pathogenesis |
| PubMed |
10424342
|
| Total Prosequence Length (aa) |
26 |
| Prosequence Location |
23:48 |
| Prosequence Sequence |
EELEAESQLMEVGMPDTELAAVDEER |
| Preproprotein Sequence |
MKVTLIAILTCAAVLVLHTTAAEELEAESQLMEVGMPDTELAAVDEERLFECSFSCEIEKEGDKPCKKKKCKGGWKCKFNMCVKV |