Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
Preproprotein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Download whole result Csv
Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions Preproprotein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ01601 FD00330 Endopolyphosphatase Q04119 Eukaryota Fungi Dikarya Ascomycota Saccharomycotina Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (strain ATCC 204508 83, 290 endopolyphosphatase activity, exopolyphosphatase activity, hydrolase activity, metal ion binding 674 Deoxyadenosine triphosphate phosphohydrolase , Exopolyphosphatase, Phosphate metabolism protein 5 PPN1 559292 cytosol, fungal-type vacuole, fungal-type vacuole membrane, integral component of membrane, nucleus polyphosphate catabolic process, polyphosphate metabolic process 15792812;15792812 373 1:83, 385:674 MVVVGKSEVRNVSMSRPKKKSLIAILSTCVLFFLVFIIGAKFQYVSVFSKFLDDRGDNESLQLLNDIEFTRLGLTPREPVIIK, EQSTRVQQGEDSNEEDEETELNRILDHAMAAKEVFLMGAKPSNKEAYMNTVRDTYYRKVWNKLERVDEKNVENEKKKKEKKDKKKKKPITRKELIERYSIVNIGGSVIPTFNPSFRIWEYNITDIVNDSNFAVSEYKPWDEFFESLNKIMEDSLLEDEMDSSNIEVGINREKMGEKKNKKKKKNDKTMPIEMPDKYELGPAYVPQLFTPTRFVQFYADLEKINQELHNSFVESKDIFRYEIEYTSDEKPYSMDSLTVGSYLDLAGRLYENKPAWEKYVEWSFASSGYKDD
PSQ01602 FD00166 Probable family 17 glucosidase SCW10 Q04951 Eukaryota Fungi Dikarya Ascomycota Saccharomycotina Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (strain ATCC 204508 11 1,3-beta-glucanosyltransferase activity, glucan endo-1,3-beta-D-glucosidase activity, glucosidase activity 389 Soluble cell wall protein 10 SCW10 559292 cell periphery, cell surface, cytoplasm, endoplasmic reticulum, extracellular region, fungal-type cell wall carbohydrate metabolic process, cell wall organization, conjugation with cellular fusion 9748433 11 19:29 APAVRHKHEKR
PSQ01603 FD00169 Inhibin beta A chain Q04998 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 288 cytokine activity, growth factor activity, hormone activity, identical protein binding, inhibin binding, peptide hormone binding, protein-containing complex binding, signaling receptor binding, type II activin receptor binding 424 Activin beta-A chain Inhba 10090 activin A complex, extracellular region, extracellular space, inhibin A complex, perinuclear region of cytoplasm activin receptor signaling pathway, cell cycle arrest, cellular response to cholesterol, cellular response to follicle-stimulating hormone stimulus, endodermal cell differentiation, extrinsic apoptotic signaling pathway, eyelid development in camera-type eye, G1/S transition of mitotic cell cycle, GABAergic neuron differentiation, hair follicle development, hematopoietic progenitor cell differentiation, hemoglobin biosynthetic process, male gonad development, mesoderm formation, mesodermal cell differentiation, negative regulation of cell cycle, negative regulation of cell growth, negative regulation of cell population proliferation, negative regulation of hair follicle development, odontogenesis, ovarian follicle development, positive regulation of cellular protein metabolic process, positive regulation of erythrocyte differentiation, positive regulation of extrinsic apoptotic signaling pathway in absence of ligand, positive regulation of gene expression, positive regulation of ovulation, positive regulation of pathway-restricted SMAD protein phosphorylation, positive regulation of transcription by RNA polymerase II, positive regulation of transcription, DNA-templated, progesterone secretion, regulation of follicle-stimulating hormone secretion, regulation of transcription by RNA polymerase II, response to drug, roof of mouth development, SMAD protein signal transduction, striatal medium spiny neuron differentiation 2133547 288 21:308 SPTPGSEGHGSAPDCPSCALATLPKDGPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQTSEIITFAESGTARKTLHFEISKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQKHPQGSLDTGDEAEEMGLKGERSELLLSEKVVDARKSTWHIFPVSSSIQRLLDQGKSSLDVRIACEQCQESGASLVLLGKKKKKEVDGDGKKKDGSDGGLEEEKEQSHRPFLMLQARQSEDHPHRRRRR
PSQ01604 FD00431 Cysteine proteinase 2 Q05094 Eukaryota Discoba Euglenozoa Kinetoplastea Metakinetoplastina Trypanosomatida Trypanosomatidae Leishmaniinae Leishmania Leishmania pifanoi 105 cysteine-type endopeptidase activity 444 Amastigote cysteine proteinase A-2 CYS2 5682 lysosome pathogenesis 8426606 105 20:124 AACAPARAIHVGTPAAALFEEFKRTYGRAYETLAEEQQRLANFERNLELMREHQARNPHAQFGITKFFDLSEAEFAARYLNGAAYFAAAKRHAAQHYRKARADLS
PSQ01605 FD00280 Alkaline phosphatase Q05205 Bacteria Proteobacteria Gammaproteobacteria Xanthomonadales Xanthomonadaceae Lysobacter Lysobacter enzymogenes 119 acid phosphatase activity, alkaline phosphatase activity 540 None phoA 69 extracellular region None 1856159 119 30:148 AQRILQLSEDTTHSKPVSAASALRGTPLAKAGAADRVCEAGAKWLRVGFKQLKLAGYDSLVLTSSGGDKLVFEGQHWNQRSFTTRPLRGECVDIQPYFSQPDSAFQLDRYDYSTVALDK
PSQ01606 FD00276 Glutamate synthase Q05755 Bacteria Proteobacteria Alphaproteobacteria Rhodospirillales Rhodospirillaceae Azospirillum Azospirillum brasilense 36 3 iron, 4 sulfur cluster binding, glutamate synthase (NADPH) activity, metal ion binding 1515 Glutamate synthase subunit alpha, NADPH-GOGAT gltB 192 None glutamine metabolic process, L-glutamate biosynthetic process 8428988 36 1:36 MTTELNQGEQFVADFRANAAALTTANAYNPEDEHDA
PSQ01607 FD00104 Regenerating islet-derived protein 3-alpha Q06141 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 11 carbohydrate binding, identical protein binding, oligosaccharide binding, peptidoglycan binding, signaling receptor activity 180 Hepatointestinal pancreatic protein, Human proislet peptide, Pancreatitis-associated protein 1, Regenerating islet-derived protein III-alpha REG3A 9606 cytoplasm, extracellular region, extracellular space acute-phase response, antimicrobial humoral immune response mediated by antimicrobial peptide, antimicrobial humoral response, cell wall disruption in other organism, heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules, negative regulation of keratinocyte differentiation, positive regulation of cell population proliferation, positive regulation of keratinocyte proliferation, positive regulation of wound healing, response to peptide hormone 19254208 11 27:37 EEPQRELPSAR
PSQ01608 FD00076 Phospholipase A1 1 Q06478 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Vespoidea Vespidae Vespinae Dolichovespula Dolichovespula maculata (Bald-faced hornet) (Vespula maculata) 10 1-acyl-2-lysophosphatidylserine acylhydrolase activity, phosphatidylserine 1-acylhydrolase activity, phospholipase A1 activity, phospholipase A2 activity, phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine), phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine), triglyceride lipase activity 317 Allergen Dol m I None 7441 extracellular region lipid catabolic process 8458431 10 8:17 DPSSSNELDR
PSQ01609 FD00295 Extracellular minor metalloprotease Q06517 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Yersiniaceae Serratia unclassified Serratia Serratia marcescens (strain ATCC 21074 218 metal ion binding, metalloendopeptidase activity 359 None smp 617 extracellular region None 8449415 218 52:269 NARAGERSAISTTPERHPTARQTGAQGGAAQQPRRAVDEAYDHLGVTYDFFWQAYRRNSVDNKGLPLVQRALRQGLPEQLSGTASRWCSETATARSSTVSPSPSTLVGHELTHGSDRERSRLIYYQQSGALNESLSDVFGSLVKQFHLQQTADKADWLIGAGLLAKGIKGKGLRSMSAPGTAYDDPLLGKDPQPASMKDYIQTKEDNGGVHLNSGIPN
PSQ01610 FND00072 Apidaecins type 14 Q06601 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Apoidea Apidae Apis Apis mellifera (Honeybee) 23, 8, 8, 6, 6 None 168 None APID14 7460 extracellular region defense response to bacterium, innate immune response 2676519;2676519;2676519;2676519;2676519 51 20:42, 63:70, 91:98, 119:124, 145:150 NTNLDPPTRPARLRREAKPEAEP, EAEPKAEP, EAESEAEP, EPEAEP, EPEAEP
PSQ01611 FND00341 Apidaecins type 73 Q06602 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Apoidea Apidae Apis Apis mellifera (Honeybee) 23, 8 None 283 None APID73 7460 extracellular region defense response to bacterium, innate immune response 2676519;2676519 31 19:41, 258:265 NTNLDPPTRPTRLRREAKPEAEP, EAKPEAKP
PSQ01612 FD00078 Cysteine proteinase 3 Q06964 Eukaryota Amoebozoa Evosea Archamoebae Mastigamoebida Entamoebidae Entamoeba Entamoeba histolytica 184 cysteine-type peptidase activity 308 Cysteine proteinase ACP3 CPNP 5759 extracellular space None 8473498 184 86:269 QAPESVDWRAQGKVTPIRDQAQCGSCYTFGSLAALEGRLLIEKGGNANTLDLSEEHLVQCTRDNGNNGCNGGLGSNVYDYIIQNGVAKESDYPYTGTDSTCKTNVKAFAKITGYNKVPRNNEAELKAALSQGLVDVSIDASSAKFQLYKSGAYSDTKCKNNFFALNHEVCAVGYGVVDGKECWI
PSQ01613 FND00019 Denmotoxin Q06ZW0 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Colubridae Colubrinae Boiga Boiga dendrophila (Mangrove snake) (Gold-ringed cat snake) 15 toxin activity 118 None None 46286 extracellular region None 16864572 15 20:34 DQLGLGRQQIDWGQG
PSQ01614 FD00192 Primary amine oxidase Q07121 Bacteria Actinobacteria Micrococcales Micrococcaceae Arthrobacter Arthrobacter sp 9 1:9 648 Copper amine oxidase, MAOXI maoI 47915 None amine metabolic process 8366046 9 1:9 MTLNAESEA
PSQ01615 FD00192 Copper methylamine oxidase Q07123 Bacteria Actinobacteria Micrococcales Micrococcaceae Arthrobacter Arthrobacter sp 9 1:9 648 MAOXII, Primary amine oxidase maoII 47915 None amine metabolic process 8366046 9 1:9 MTLNAESEA
PSQ01616 FD00095 Serralysin G Q07162 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Pectobacteriaceae Dickeya Dickeya chrysanthemi (Pectobacterium chrysanthemi) (Erwinia chrysanthemi) 14 calcium ion binding, metalloendopeptidase activity, zinc ion binding 480 Secreted protease G prtG 556 extracellular matrix, extracellular space None 1299839 14 1:14 MALYGKKTDLSSAS
PSQ01617 FD00095 Serralysin A Q07295 Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Pectobacteriaceae Dickeya Dickeya chrysanthemi (Pectobacterium chrysanthemi) (Erwinia chrysanthemi) 17 calcium ion binding, metalloendopeptidase activity, zinc ion binding 479 Secreted protease A prtA 556 extracellular matrix, extracellular space None 1494344 17 1:17 MEKNLSSRDDDALHSLS
PSQ01618 FD00004 Thrombin-like enzyme asperase Q072L6 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Bothrops Bothrops asper (Terciopelo) 6 serine-type endopeptidase activity, toxin activity 259 Fibrinogen-clotting enzyme, Snake venom serine protease None 8722 extracellular region None 17994164 6 19:24 QKSSEL
PSQ01619 FD00047 M-myrmeciitoxin-Mp1 Q07932 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Formicoidea Formicidae Myrmeciinae Myrmeciini Myrmecia Myrmecia pilosula (Jack jumper ant) (Australian jumper ant) 30 None 119 Allergen Myr p I, Major allergen Myr p 1 , Pilosulin-1 None 13618 extracellular space cytolysis by symbiont of host cells, defense response to fungus, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, hemolysis in other organism 15019477, 8866004 30 27:56 KDLADPESEAVGFADAFGEADAVGEADPNA
PSQ01620 FD00363 Neutral metalloprotease ShpI Q08002 Bacteria Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus hyicus 75 metalloendopeptidase activity, zinc ion binding 438 None shpI 1284 extracellular region None 8121397 75 27:101 DAHTYIINNEDINKNAQESSIGTLKQNNFKQSTIDSMKPRNLQSFQEDKVFKAPKEKTPITERARKSENALSNSK
PSQ01621 FD00201 Metacaspase-1 Q08601 Eukaryota Fungi Dikarya Ascomycota Saccharomycotina Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (strain ATCC 204508 269 calcium-dependent cysteine-type endopeptidase activity 432 None MCA1 559292 cytosol, nucleus apoptotic process, protein quality control for misfolded or incompletely synthesized proteins 22761449 269 1:269 MYPGSGRYTYNNAGGNNGYQRPMAPPPNQQYGQQYGQQYEQQYGQQYGQQNDQQFSQQYAPPPGPPPMAYNRPVYPPPQFQQEQAKAQLSNGYNNPNVNASNMYGPPQNMSLPPPQTQTIQGTDQPYQYSQCTGRRKALIIGINYIGSKNQLRGCINDAHNIFNFLTNGYGYSSDDIVILTDDQNDLVRVPTRANMIRAMQWLVKDAQPNDSLFLHYSGHGGQTEDLDGDEEDGMDDVIYPVDFETQGPIIDDEMHDIMVKPLQQGVRL
PSQ01622 FD00218 Major microneme antigen Q08668 Eukaryota Sar Alveolata Apicomplexa Conoidasida Coccidia Eucoccidiorida Eimeriorina Sarcocystidae Sarcocystis Sarcocystis muris 69 carbohydrate binding 241 Lectin SML1 None 5813 cytoplasmic vesicle, extracellular region, microneme proteolysis 8114823, 8801555 69 35:103 AADALSWSGGLIHSPAHRVNVMRSHHHEMGKELEQQHGGEEQQMQRDTKPAAFSNPPHLATGRGPSFVH
PSQ01623 FND00220 Pro-P-factor Q09180 Eukaryota Fungi Dikarya Ascomycota Taphrinomycotina Schizosaccharomycetes Schizosaccharomycetales Schizosaccharomycetaceae Schizosaccharomyces Schizosaccharomyces pombe (strain 972 8 mating pheromone activity 201 None map2 284812 cell surface, extracellular region cell cycle, cell-cell signaling, induction of conjugation upon nitrogen starvation, induction of conjugation with cellular fusion, positive regulation of pheromone response MAPK cascade, regulation of cell cycle switching, mitotic to meiotic cell cycle, signal transduction involved in positive regulation of conjugation with cellular fusion 8314086 8 58:65 EFEAAPAK
PSQ01624 FD00594 Protein lgg-1 Q09490 Eukaryota Metazoa Ecdysozoa Nematoda Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans 7 GABA receptor binding, ubiquitin protein ligase binding 123 None lgg-1 6239 autophagosome, autophagosome membrane, cytoplasm, cytosol, dendrite, lysosomal lumen, mitochondrial outer membrane, neuron projection, neuronal cell body, nucleus, perikaryon, phagocytic vesicle membrane, phagophore assembly site, plasma membrane autophagosome assembly, autophagy, autophagy of mitochondrion, cellular response to nitrogen starvation, dauer larval development, defense response to Gram-positive bacterium, determination of adult lifespan, macroautophagy, plasma membrane repair, positive regulation of autophagosome assembly, positive regulation of necrotic cell death, programmed cell death, xenophagy 20550938, 21802374 7 117:123 GEVEKKE
PSQ01625 FD00168 Probable insulin-like peptide beta-type 1 Q09626 Eukaryota Metazoa Ecdysozoa Nematoda Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans 32 hormone activity 106 None ins-4 6239 extracellular region dauer larval development, negative regulation of dauer entry, regulation of synaptic growth at neuromuscular junction 23665919 32 20:51 RQPSMDTSKADRILREIEMETELENQLSRARR
PSQ01626 FD00214 Retroviral-like aspartic protease 1 Q09PK2 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 188, 15 aspartic-type endopeptidase activity 339 Skin-specific retroviral-like aspartic protease, TPA-inducible aspartic proteinase-like protein Asprv1 10090 integral component of membrane protein processing, skin development 16837463;16837463 203 1:188, 325:339 MRNPGGPGWASKRPLQKKQNTACLCAQQPARHFVPAPFNSSRQGKNTAQPTEPSLSSVIAPTLFCAFLYLACVTAELPEVSRRMATSGVRSKEGRREHAFVPEPFTGTNLAPSLWLHRFEVIDDLNHWDHATKLRFLKESLKGDALDVYNGLSSQAQGDFSFVKQALLRAFGAPGEAFSEPEEILFAN, LIEEEEGSSAPEGSH
PSQ01627 FND00302 Lantibiotic michiganin-A Q09T02 Bacteria Actinobacteria Micrococcales Microbacteriaceae Clavibacter Clavibacter michiganensis subsp 47 signaling receptor binding 68 None micA 33013 extracellular region cytolysis, defense response to Gram-positive bacterium, pore complex assembly 16957199 47 1:47 MNDILETETPVMVSPRWDMLLDAGEDTSPSVQTQIDAEFRRVVSPYM
PSQ01628 FND00229 Kappa-actitoxin-Aer3a Q0EAE5 Eukaryota Metazoa Cnidaria Anthozoa Hexacorallia Actiniaria Actiniidae Anemonia Anemonia erythraea (Sea anemone) 27 toxin activity 83 AnerK , Potassium channel toxin AETX K None 48400 extracellular region, nematocyst None 16905168 27 23:49 QNLRAEELEKANPKDERVRSFERNQKR
PSQ01629 FD00114 Potassium channel toxin Tdi-beta-KTx Q0GY44 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Scorpiones Buthida Buthoidea Buthidae Tityus Tityus discrepans (Venezuelan scorpion) 8 toxin activity 87 None None 57059 extracellular region None 17141373 8 20:27 GLREKHVQ
PSQ01630 FD00221 Bowman-Birk type bran trypsin inhibitor Q0JR25 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida Liliopsida Poales Poaceae BOP clade Oryzoideae Oryzeae Oryzinae Oryza Oryza sativa Oryza sativa subsp 96 serine-type endopeptidase inhibitor activity 254 OSE727A, Protein RBBI3-3, RBTI RBBI3 39947 extracellular region None 3667571 96 23:118 HGDGDTTIRLPSDGAKASRPRAAKPWDCCDNIEISRLMIYPPLYRCNDEVKQCAAACKECVEAPGGDFNGGAFVCSDWFSTVDPGPKCTAALDGLS
PSQ01631 FND00177 Antimicrobial peptide aurelin Q0MWV8 Eukaryota Metazoa Cnidaria Scyphozoa Semaeostomeae Ulmaridae Aurelia Aurelia aurita (Moon jellyfish) 22 None 84 None None 6145 extracellular region, membrane, other organism cell membrane defense response to bacterium 16890198 22 23:44 EDEVNLQAQIEEGPMEAIRSRR
PSQ01632 FND00179 Alpha Q0N4U8 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Strategoconus Conus planorbis (Planorbis cone) 15 toxin activity 76 None None 97183 extracellular region, host cell postsynaptic membrane None 16819832 15 25:39 GSPGTAQLSGHRTAR
PSQ01633 FD00018 Disintegrin jarastatin Q0NZX5 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Bothrops Bothrops jararaca (Jararaca) (Bothrops jajaraca) 15 toxin activity 88 Platelet aggregation activation inhibitor None 8724 extracellular region apoptotic process, chemotaxis 10471323 15 1:15 RTDTVSTPVSGNELL
PSQ01634 FND00091 Tryptophyllin-T1 Q0VKG8 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Pithecopus Pithecopus azureus (Orange-legged monkey tree frog) (Phyllomedusa azurea) 31 None 61 Tryptophyllin-5 , Tryptophyllin-HA5 trp-Pha-T1 2034991 extracellular region defense response 17696382 31 23:53 DEEKRQDDDEASEREEKKEIHEEGNQEERRD
PSQ01635 FND00010 Probradykinin-2 Q0VTT8 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Pithecopus Pithecopus azureus (Orange-legged monkey tree frog) (Phyllomedusa azurea) 28 toxin activity 61 None pb-H2 2034991 extracellular region defense response, vasodilation 17120273 28 23:50 EEEKRETEEEENEDEIEEQSEEKKRFEP
PSQ01636 FND00010 Phyllokinin-1 Q0VTT9 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Pithecopus Pithecopus azureus (Orange-legged monkey tree frog) (Phyllomedusa azurea) 29 toxin activity 62 None pp-H1 2034991 extracellular region defense response 17120273 29 20:48 SICEEEKRETEEEENEDEIEEESEEKKRE
PSQ01637 FND00010 Probradykinin-1 Q0VTU0 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Pithecopus Pithecopus azureus (Orange-legged monkey tree frog) (Phyllomedusa azurea) 26 toxin activity 61 None pb-H1 2034991 extracellular region defense response, vasodilation 17120273 26 23:48 EEEKRETEEEENKDETEEQSEEKKRF
PSQ01638 FND00005 Phylloseptin-H9 Q0VZ38 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Pithecopus Pithecopus hypochondrialis (Orange-legged leaf frog) (Phyllomedusa, hypochondrialis) 22 None 66 Phylloseptin-11 , Phylloseptin-9 psn-11 317381 extracellular region defense response 16713656 22 23:44 EEEKRETEEEENDQEEDDKSEE
PSQ01639 FND00005 Phylloseptin-H8 Q0VZ39 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Pithecopus Pithecopus hypochondrialis (Orange-legged leaf frog) (Phyllomedusa, hypochondrialis) 22 None 66 Phylloseptin-10 psn-10 317381 extracellular region defense response 16713656 22 23:44 EEEKRETEEEENDQEEDDKSEE
PSQ01640 FND00005 Phylloseptin-H7 Q0VZ40 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Pithecopus Pithecopus hypochondrialis (Orange-legged leaf frog) (Phyllomedusa, hypochondrialis) 22 None 66 Phylloseptin-11 , Phylloseptin-9 psn-9 317381 extracellular region defense response 16713656 22 23:44 EEEKRETEEEENDQEEDDKSEE
PSQ01641 FND00005 Phylloseptin-H6 Q0VZ41 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Pithecopus Pithecopus hypochondrialis (Orange-legged leaf frog) (Phyllomedusa, hypochondrialis) 22 None 66 Phylloseptin-8 psn-8 317381 extracellular region defense response to bacterium 16713656 22 23:44 EEEKRETEEEEYNQEDDDKSEE
PSQ01642 FD00362 Subtilisin-like protease SBT6 Q0WUG6 Eukaryota Viridiplantae Streptophyta Embryophyta Tracheophyta Spermatophyta Magnoliopsida eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) 151 endopeptidase activity, serine-type endopeptidase activity 1038 Site-1 protease , Subtilase subfamily 6 member 1 SBT6 3702 Golgi apparatus, Golgi membrane, integral component of membrane hyperosmotic response, hyperosmotic salinity response, proteolysis 17662035 151 31:181 STYHPQQQNLNPENVTRLESENETKTNYIIRFKQYKPAKDHRIYLESKVRSGGWGWIERINPATKYPTDFGVLWIEESGKEAVVGEIERLEMVKDVNVEFKYQRVLLGGSFPDGKKRPGKIFTSMSFEEGTESSPMADTSNTTLNWSRHLL
PSQ01643 FD00224 Disintegrin and metalloproteinase domain-containing protein 10 Q10741 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos Bos taurus (Bovine) 194 endopeptidase activity, metal ion binding, metalloendopeptidase activity, metalloendopeptidase activity involved in amyloid precursor protein catabolic process, metallopeptidase activity, protein homodimerization activity, protein kinase binding, SH3 domain binding 748 Kuzbanian protein homolog, Mammalian disintegrin-metalloprotease, Myelin-associated metalloproteinase ADAM10 9913 adherens junction, axon, cell surface, clathrin-coated vesicle, cytoplasm, dendrite, glutamatergic synapse, Golgi apparatus, Golgi membrane, Golgi-associated vesicle, nucleus, perinuclear endoplasmic reticulum, plasma membrane, pore complex, postsynaptic density, synaptic membrane, tetraspanin-enriched microdomain adherens junction organization, amyloid precursor protein catabolic process, cochlea development, constitutive protein ectodomain proteolysis, in utero embryonic development, membrane protein ectodomain proteolysis, monocyte activation, negative regulation of cell adhesion, negative regulation of gene expression, Notch signaling pathway, pore complex assembly, positive regulation of cell growth, positive regulation of cell population proliferation, positive regulation of T cell chemotaxis, postsynapse organization, protein phosphorylation, protein processing, regulation of neurotransmitter receptor localization to postsynaptic specialization membrane, regulation of Notch signaling pathway, regulation of vasculature development, response to tumor necrosis factor, toxin transport 10097139, 11481247 194 20:213 QYGNPLNKYIRHYEGLSYDVDSLHQKHQRAKRAVSHEDQFLRLDFHAHGRHFNLRMKRDTSLFSEEFRVETSNAVLDYDTSHIYTGHIYGEEGSFSHGSVIDGRFEGFIQTHGGTFYVEPAERYIKDRTLPFHSVIYHEDDIKYPHKYGPQGGCADHSVFERMRKYQMTGVEEVTQTPQEKHAINGPELLRKKR
PSQ01644 FD00013 Snake venom metalloproteinase-disintegrin-like mocarhagin Q10749 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Elapidae Elapinae Naja Naja mossambica (Mozambique spitting cobra) 171 metalloendopeptidase activity, peptidase activity, toxin activity, zinc ion binding 609 Zinc metalloproteinase mocarhagin None 8644 extracellular region negative regulation of blood coagulation 8664285 171 21:191 IILESGNVNDYEVVYPQKVPALSKGGVQNPQPETKYEDTMQYEFHVNGEPVVLHLERNKGLFSEDYTETHYAPDGREITTSSPVQDHCYYHGYIQNEADSSAVISACDGLKGHFKHQGETYFIEPLELSDSEAHAIYKDENVEEEEEIPKICGVTQTTWESDEPIEKSSQL
PSQ01645 FD00187 Membrane alanyl aminopeptidase Q11000 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Lepidoptera Glossata Ditrysia Noctuoidea Noctuidae Heliothinae Heliothis Heliothis virescens (Tobacco budworm moth) 37 aminopeptidase activity, metallopeptidase activity, zinc ion binding 1009 Aminopeptidase N-like protein, BTBP1, CryIA(C) receptor None 7102 anchored component of membrane, plasma membrane None 7592988 37 16:52 VIAHSPIPPASRTIFLDERLEGGAFENIDAFENIELS
PSQ01646 FD00557 Versicolorin B synthase Q12062 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Eurotiales Aspergillaceae Aspergillus Aspergillus parasiticus (strain ATCC 56775 41 flavin adenine dinucleotide binding, hydro-lyase activity, oxidoreductase activity, acting on CH-OH group of donors, protein homodimerization activity, versicolorin B synthase activity 643 5, Aflatoxin biosynthesis protein K aflK 1403190 cytosol aflatoxin biosynthetic process 15932995 41 1:41 MGRNWFQVTAMAVVPVVGIMAAVNPTILSSAASSLPSLGAM
PSQ01647 FD00543 Sterigmatocystin 8-O-methyltransferase Q12120 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Eurotiales Aspergillaceae Aspergillus Aspergillus parasiticus (strain ATCC 56775 41 sterigmatocystin 7-O-methyltransferase activity 420 Aflatoxin biosynthesis protein P aflP 1403190 vacuole aflatoxin biosynthetic process, methylation 8434913 41 1:41 MALPSKAALVGLANTLSEQVKRYLATAGETKSPEDHKLCIE
PSQ01648 FD00024 Aspartic proteinase yapsin-3 Q12303 Eukaryota Fungi Dikarya Ascomycota Saccharomycotina Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (strain ATCC 204508 27 aspartic-type endopeptidase activity 508 None YPS3 559292 anchored component of plasma membrane, extracellular region, fungal-type cell wall fungal-type cell wall organization 10191273 27 21:47 RVLPDGKYVKIPFTKKKNGDNGELSKR
PSQ01649 FD00030 Aspergillopepsin-1 Q12567 Eukaryota Fungi Dikarya Ascomycota Pezizomycotina Eurotiomycetes Eurotiomycetidae Eurotiales Aspergillaceae Aspergillus Aspergillus phoenicis (Aspergillus saitoi) 49 aspartic-type endopeptidase activity 394 Aspartic protease pepA, Aspergillopepsin I , Aspergillopeptidase A, Protease type XIII pepA 5063 extracellular region None 8142467 49 21:69 APAPTRKGFTINQIARPANKTRTVNLPGLYARSLAKFGGTVPQSVKEAA
PSQ01650 FD00325 Glutamate synthase Q12680 Eukaryota Fungi Dikarya Ascomycota Saccharomycotina Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (strain ATCC 204508 53 3 iron, 4 sulfur cluster binding, flavin adenine dinucleotide binding, FMN binding, glutamate synthase (NADH) activity, glutamate synthase activity, iron ion binding, oxidoreductase activity 2145 NADH-GOGAT GLT1 559292 mitochondrion ammonia assimilation cycle, glutamate biosynthetic process, L-glutamate biosynthetic process 7836314 53 1:53 MPVLKSDNFDPLEEAYEGGTIQNYNDEHHLHKSWANVIPDKRGLYDPDYEHDA
Total Pages 43
Go to Lab Web Page