Home Advance Search BLAST Contact Documentation/Help Feedback
Family
Protein Name
Uniprot ID
Taxonomy
Organism
Prosequence length
Functions
Preproprotein length
Alt Name
Gene Name
NCBI ID
Cell Org
Process
PubMed
Total Proseq length
Proseq Loc
Prosequence Sequence

Download whole result Csv
Proseq ID Family Protein Name Uniprot ID Taxonomy Organism Prosequence length Functions Preproprotein length Alter Name Gene Name NCBI ID Cell Org Process PubMed Total Proseq length Proseq Loc Prosequence Sequence
PSQ01651 FD00585 Pappalysin-1 Q13219 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 59 metalloendopeptidase activity, metallopeptidase activity, zinc ion binding 1627 Insulin-like growth factor-dependent IGF-binding protein 4 protease, Pregnancy-associated plasma protein A PAPPA 9606 extracellular region, extracellular space cellular protein metabolic process, female pregnancy, response to follicle-stimulating hormone, response to glucocorticoid 7508748, 7685339 59 23:81 ERPRRARRDPRAGRPPRPAAGPATCATRAARGRRASPPPPPPPGGAWEAVRVPRRRQQR
PSQ01652 FD00530 Apolipoprotein F Q13790 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 129 cholesterol binding, lipid transporter activity, signaling receptor binding 326 Lipid transfer inhibitor protein APOF 9606 extracellular space, high-density lipoprotein particle, low-density lipoprotein particle cholesterol metabolic process, lipid metabolic process, lipid transport 8093033, 9880564 129 36:164 ATSYGKQTNVLMHFPLSLESQTPSSDPLSCQFLHPKSLPGFSHMAPLPKFLVSLALRNALEEAGCQADVWALQLQLYRQGGVNATQVLIQHLRGLQKGRSTERNVSVEALASALQLLAREQQSTGRVGR
PSQ01653 FD00197 Ectonucleotide pyrophosphatase Q13822 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 8 alkylglycerophosphoethanolamine phosphodiesterase activity, calcium ion binding, hydrolase activity, lysophospholipase activity, nucleic acid binding, nucleotide diphosphatase activity, phosphodiesterase I activity, polysaccharide binding, scavenger receptor activity, transcription factor binding, zinc ion binding 863 Autotaxin , Extracellular lysophospholipase D ENPP2 9606 extracellular space, plasma membrane cell motility, chemotaxis, immune response, phosphatidylcholine catabolic process, phospholipid catabolic process, positive regulation of epithelial cell migration, positive regulation of lamellipodium morphogenesis, positive regulation of peptidyl-tyrosine phosphorylation, regulation of angiogenesis, regulation of cell migration, sphingolipid catabolic process 12176993, 18175805 8 28:35 FTAHRIKR
PSQ01654 FD00208 Caspase-8 Q14790 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 216, 10 cysteine-type endopeptidase activity, cysteine-type endopeptidase activity involved in apoptotic process, cysteine-type endopeptidase activity involved in apoptotic signaling pathway, cysteine-type endopeptidase activity involved in execution phase of apoptosis, cysteine-type peptidase activity, death effector domain binding, death receptor binding, identical protein binding, peptidase activity, protein-containing complex binding, scaffold protein binding, tumor necrosis factor receptor binding, ubiquitin protein ligase binding 480 Apoptotic cysteine protease, Apoptotic protease Mch-5 , CAP4, FADD-homologous ICE, FADD-like ICE , ICE-like apoptotic protease 5, MORT1-associated ced-3 homolog CASP8 9606 CD95 death-inducing signaling complex, cell body, cytoplasm, cytoskeleton, cytosol, death-inducing signaling complex, membrane raft, mitochondrial outer membrane, mitochondrion, neuron projection, nucleoplasm, protein-containing complex, ripoptosome activation of cysteine-type endopeptidase activity, activation of cysteine-type endopeptidase activity involved in apoptotic process, activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway, angiogenesis, apoptotic process, apoptotic signaling pathway, B cell activation, cell surface receptor signaling pathway, cellular response to mechanical stimulus, cellular response to organic cyclic compound, death-inducing signaling complex assembly, execution phase of apoptosis, extrinsic apoptotic signaling pathway, extrinsic apoptotic signaling pathway via death domain receptors, heart development, macrophage differentiation, modulation by virus of host cellular process, natural killer cell activation, negative regulation of extrinsic apoptotic signaling pathway via death domain receptors, negative regulation of I-kappaB kinase/NF-kappaB signaling, negative regulation of necroptotic process, nucleotide-binding oligomerization domain containing signaling pathway, positive regulation of apoptotic process, positive regulation of I-kappaB kinase/NF-kappaB signaling, positive regulation of interleukin-1 beta production, positive regulation of macrophage differentiation, positive regulation of neuron death, positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway, positive regulation of proteolysis, proteolysis, proteolysis involved in cellular protein catabolic process, pyroptosis, regulation of cytokine production, regulation of extrinsic apoptotic signaling pathway via death domain receptors, regulation of innate immune response, regulation of necroptotic process, regulation of tumor necrosis factor-mediated signaling pathway, response to antibiotic, response to cobalt ion, response to cold, response to estradiol, response to ethanol, response to lipopolysaccharide, response to tumor necrosis factor, self proteolysis, suppression by virus of host cysteine-type endopeptidase activity involved in apoptotic process, syncytiotrophoblast cell differentiation involved in labyrinthine layer development, T cell activation, toll-like receptor 3 signaling pathway, TRAIL-activated apoptotic signaling pathway, TRIF-dependent toll-like receptor signaling pathway 8962078, 9184224,;8962078, 9184224 226 1:216, 375:384 MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQD, SEEQPYLEMD
PSQ01655 FD00134 Unique cartilage matrix-associated protein Q14BU0 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Glires Rodentia Myomorpha Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) 37 BMP binding 138 Upper zone of growth plate and cartilage matrix associated protein Ucma 10090 aggresome, cytoplasm, cytoskeleton, extracellular matrix, extracellular region, extracellular space, Golgi apparatus, perinuclear region of cytoplasm embryonic skeletal system development, negative regulation of biomineralization, negative regulation of osteoblast differentiation, negative regulation of SMAD protein signal transduction 18156182 37 28:64 SVGSRQAAAEGVQEGVKQKIFMQESDASNFLKRRGKR
PSQ01656 FD00080 Guanylate cyclase activator 2B Q16661 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 62 calcium sensitive guanylate cyclase activator activity, guanylate cyclase activator activity 119 None GUCA2B 9606 extracellular exosome, extracellular region cGMP-mediated signaling, digestion, excretion 7589507 62 27:88 VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSI
PSQ01657 FD00279 Meprin A subunit beta Q16820 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo Homo sapiens (Human) 39 identical protein binding, metalloendopeptidase activity, zinc ion binding 701 Endopeptidase-2, Meprin B, N-benzoyl-L-tyrosyl-P-amino-benzoic acid hydrolase subunit beta, PABA peptide hydrolase, PPH beta MEP1B 9606 extracellular region, integral component of plasma membrane, meprin A complex inflammatory response, toxin transport 8262185, 9288916 39 23:61 TPENFDVDGGMDQDIFDINEGLGLDLFEGDIRLDRAQIR
PSQ01658 FND00005 Phylloseptin-Az4 Q17UY9 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Pithecopus Pithecopus azureus (Orange-legged monkey tree frog) (Phyllomedusa azurea) 22 None 60 Phylloseptin-12 psn12 2034991 extracellular region defense response to bacterium 17553595 22 14:35 EEEKRETEEEENDQEEDDKSEE
PSQ01659 FD00085 Aspartic protease 10 Q18020 Eukaryota Metazoa Ecdysozoa Nematoda Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans 289 aspartic-type endopeptidase activity 428 Heme transporter hrg-7 , Heme-responsive gene 7 protein hrg-7 6239 extracellular region, lysosome cell death 28581477 289 17:305 EVHQFNIGYRPNMRQRMNAKGKLAEYEKERNELLSKKSLQLASSSSPVIDYEDMAYMVQISLGSPAQNFVLFIDSGSSNLWVPDITCAGGKDATCGSYCKSTPYDACLTFCQEECCTKTVEGVKVLSTTDACQSKHRFNSSLSSSYVTNGQKFDMTYNTGEVKGFFGVDTFCFTNTSVCATGQVFGQATTIGEAFAKQPEDGIIGLGWPALAVNQQTPPLFNLMNQGKLDQPYFVVYLANIGPTSQINGGAFTVGGLDTTHCSSNVDWVPLSTQTFWQFKLGGVSSGSY
PSQ01660 FND00200 FMRFamide-like neuropeptides 27 Q18184 Eukaryota Metazoa Ecdysozoa Nematoda Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans 12, 26 None 89 None flp-27 6239 extracellular region neuropeptide signaling pathway 19456328;19456328 38 24:35, 64:89 QPIDEERPIFME, SSSPDISLAEMRAIYGGDQSNIFNFK
PSQ01661 FD00273 Neuronal immunoglobulin domain-containing protein rig-3 Q18806 Eukaryota Metazoa Ecdysozoa Nematoda Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans 21 cell-cell adhesion mediator activity 487 None rig-3 6239 anchored component of membrane, axon, plasma membrane, synapse axon guidance, dendrite self-avoidance, homophilic cell adhesion via plasma membrane adhesion molecules 21745641 21 467:487 SASDSKFPLALATLFFVCLFI
PSQ01662 FD00048 Osteocalcin 1 Q1EG28 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Actinopterygii Neopterygii Teleostei Neoteleostei Acanthomorphata Carangaria Pleuronectiformes Pleuronectoidei Soleidae Solea Solea senegalensis (Senegalese sole) 29 calcium ion binding 95 Bone Gla protein , Gamma-carboxyglutamic acid-containing protein bglapBGP 28829 extracellular region biomineral tissue development, bone development, regulation of cellular response to insulin stimulus, response to vitamin K 24185858 29 22:50 SFSSQPAVDTPAQEGLFVEQEQASSVVRQ
PSQ01663 FD00002 Dermaseptin-H5 Q1EJP4 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Pithecopus Pithecopus azureus (Orange-legged monkey tree frog) (Phyllomedusa azurea) 21 None 68 Dermaseptin-like peptide 5 dpp-H5 2034991 extracellular region defense response to bacterium 17553595 21 18:38 EEEKRENEDEEKQEDDEQSEM
PSQ01664 FD00002 Dermaseptin-H4 Q1EJP5 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Pithecopus Pithecopus azureus (Orange-legged monkey tree frog) (Phyllomedusa azurea) 21 None 73 Dermaseptin-like peptide 4 dpp-H4 2034991 extracellular region defense response to bacterium 17553595 21 23:43 EEEKRENEDEAKQEDDEQSEM
PSQ01665 FD00059 M-zodatoxin-Lt1a Q1ELT9 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Zodariidae Lachesana Lachesana tarabaevi (Spider) 40 toxin activity 88 Latarcin-1 None 379576 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 16735513 40 23:62 YDVNEELENELDDLSDAAWLAKAAEDLQALDDFEESEESR
PSQ01666 FD00059 M-zodatoxin-Lt2a Q1ELU1 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Zodariidae Lachesana Lachesana tarabaevi (Spider) 36 toxin activity 84 Latarcin-2a None 379576 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 16735513 36 23:58 YEVNEELENELDDLDDAAWLAVAEELQGLEDFEESR
PSQ01667 FND00059 M-zodatoxin-Lt3b Q1ELU2 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Zodariidae Lachesana Lachesana tarabaevi (Spider) 39 toxin activity 82 Latarcin-3b None 379576 extracellular region defense response to bacterium, defense response to fungus, killing of cells of other organism 16735513 39 23:61 YPVEDLEDDELTELEAEALLEDLLEDLELEDLDYNEEAR
PSQ01668 FND00059 M-zodatoxin-Lt3a Q1ELU3 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Zodariidae Lachesana Lachesana tarabaevi (Spider) 39 toxin activity 82 La47, Latarcin-3a None 379576 extracellular region, membrane, other organism cell membrane defense response to bacterium, defense response to fungus, killing of cells of other organism 16735513, 23093034 39 23:61 YPVEDLEDDELTELEAEALLEDLLEDLELEDLDYNEEAR
PSQ01669 FND00231 M-zodatoxin-Lt4b Q1ELU4 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Zodariidae Lachesana Lachesana tarabaevi (Spider) 21, 9, 9, 9, 8 toxin activity 180 None None 379576 extracellular region defense response to bacterium, defense response to fungus, killing of cells of other organism 16735513;27287558;27287558;27287558;27287558 56 23:43, 63:71, 91:99, 119:127, 147:154 EEEGYDVSEEIQAEELEEAAR, REDSEDAGR, REDTEEAGR, REDSEEAGR, REDTEEAR
PSQ01670 FD00059 M-zodatoxin-Lt4a Q1ELU5 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Zodariidae Lachesana Lachesana tarabaevi (Spider) 9, 9, 9, 9, 8 toxin activity 207 None None 379576 extracellular region defense response to bacterium, defense response to fungus, killing of cells of other organism 27287558;27287558;27287558;27287558;27287558 44 63:71, 91:99, 119:127, 147:155, 175:182 REDSEEAGR, REDSEEAGR, REDSEEAGR, REDSEEAGR, REDTEEAR
PSQ01671 FD00059 M-zodatoxin-Lt5a Q1ELU9 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Entelegynae incertae sedis Zodariidae Lachesana Lachesana tarabaevi (Spider) 42 toxin activity 93 Latarcin-5 None 379576 extracellular region defense response to bacterium, defense response to fungus, hemolysis in other organism 16735513 42 23:64 TETGYAVAETLEDNDLDELQAYLEEIAEASEMEDFSNIEEAR
PSQ01672 FND00004 Dermaseptin-S13 Q1EN11 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Phyllomedusa Phyllomedusa sauvagei (Sauvage 23 None 73 None None 8395 extracellular region, membrane, other organism cell membrane defense response to bacterium, defense response to fungus, innate immune response, killing of cells of other organism 16401077 23 23:45 DEEKRENEDEENQEDDEQSEMRR
PSQ01673 FND00004 Dermaseptin-S12 Q1EN12 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Phyllomedusa Phyllomedusa sauvagei (Sauvage 23 None 72 None None 8395 extracellular region, membrane, other organism cell membrane defense response to bacterium, defense response to fungus, innate immune response, killing of cells of other organism 16401077 23 22:44 EEEKRENEDEENQEDDEQSEMRR
PSQ01674 FD00002 Dermaseptin-S11 Q1EN13 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Phyllomedusa Phyllomedusa sauvagei (Sauvage 23 None 75 None None 8395 extracellular region, membrane, other organism cell membrane defense response to bacterium, defense response to fungus, innate immune response, killing of cells of other organism 16401077 23 23:45 EEEKRENEDEEEQEDDEQSEEKR
PSQ01675 FND00016 Plasticin-S1 Q1EN14 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Phyllomedusa Phyllomedusa sauvagei (Sauvage 23 None 70 Dermaseptin-S10 None 8395 extracellular region None 16401077 23 23:45 EEEKREGENEKEQEDDNQSEEKR
PSQ01676 FND00004 Atypical cationic antimicrobial peptide Q1EN15 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Amphibia Batrachia Anura Neobatrachia Hyloidea Hylidae Phyllomedusinae Phyllomedusa Phyllomedusa sauvagei (Sauvage 23 None 69 Dermaseptin-S9 None 8395 extracellular region, membrane, other organism cell membrane chemotaxis, defense response to bacterium, innate immune response 16401077 23 23:45 DEEKRENEDEENQEDDEQSEMRR
PSQ01677 FD00565 Monalysin Q1I8U1 Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas entomophila (strain L48) 33 porin activity, toxin activity 271 beta-barrel pore-forming toxin mnl 384676 extracellular region, host cell plasma membrane, pore complex hemolysis in other organism, ion transport, pathogenesis, protein homooligomerization 21980286 33 1:33 MTIKEELGQPQSHSIELDEVSKEAASTRAALTS
PSQ01678 FD00149 Photosystem II protein D1 Q1KVU8 Eukaryota Viridiplantae Chlorophyta core chlorophytes Chlorophyceae Sphaeropleales Scenedesmaceae Tetradesmus Tetradesmus obliquus (Green alga) (Acutodesmus obliquus) 9 chlorophyll binding, electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity, iron ion binding, oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor, oxygen evolving activity 360 Photosystem II Q(B) protein psbA 3088 chloroplast thylakoid membrane, integral component of membrane, photosystem II photosynthetic electron transport in photosystem II, protein-chromophore linkage, response to herbicide 9252339 9 345:353 SVEAPSVNA
PSQ01679 FND00104 FMRFamide-related peptides Q1MX22 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Lepidoptera Glossata Ditrysia Bombycoidea Bombycidae Bombycinae Bombyx Bombyx mori (Silk moth) 11, 47, 19, 33 None 180 Bommo-FMRFamide RFa 7091 extracellular region neuropeptide signaling pathway 16707581;16707581;16707581;16707581 110 22:32, 47:93, 113:131, 145:177 TPVRRSPDLEA, RSTLPVVPPAQPSFLQRYSAPQPAALTADDLMTFLRAYEEDYSSPVS, RSVDEENSGYQAETNTYPQ, RDNELSESNDEDRYEVESERTKRSVVDPCNDCA
PSQ01680 FD00013 Zinc metalloproteinase-disintegrin-like BjussuMP-1 Q1PHZ4 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Bothrops Bothrops jararacussu (Jararacussu) 133 metal ion binding, metalloendopeptidase activity, toxin activity 547 BjussuMP-I, Snake venom metalloproteinase None 8726 extracellular region defense response to bacterium 17081786 133 1:133 EFKVNGEPVVLHLEKNKGLFSEDYSETHYSPDGRQITTYPPVEDHCYYHGRIENDADSTASISACNGLKGHFKLQGETYLIEPLKLSDSEAHAVYKYENVEKEDEAPKMCGVTETNWEYEEPIKKASKLVVTA
PSQ01681 FD00223 Metalloprotease mig-17 Q20930 Eukaryota Metazoa Ecdysozoa Nematoda Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans 186 metal ion binding, metalloendopeptidase activity, metallopeptidase activity 509 Abnormal cell migration protein 17 mig-17 6239 basement membrane, extracellular space gonad morphogenesis, protein autoprocessing, protein localization, regulation of cell migration, regulation of distal tip cell migration, zymogen activation 18637819 186 21:206 ARREKQQSNDISFVKRKVQDGLKFSRVIKYTNETIQGMKTNFNSNKTQELSLDVLVVADFLSYQAFLEMSNGDSHRAIHNLKEYLHALFEQTKIIYDGISFGNETLHMVFAGTWIATQERDCPLWISWAEEEEERVLNEEIRRLEEKERDLNSTFVDDTFFMNSTDSDNSSTDALISSDMPKKLRK
PSQ01682 FD00456 Lysosomal beta glucosidase Q23892 Eukaryota Amoebozoa Evosea Eumycetozoa Dictyostelia Dictyosteliales Dictyosteliaceae Dictyostelium Dictyostelium discoideum (Slime mold) 45 beta-glucosidase activity, scopolin beta-glucosidase activity 821 None gluA 44689 lysosome glucan catabolic process 8288612 45 25:69 SSIRVSIVGGEEAEVIEKPRTFGNKRELKLEYSQIYPKKQLNQEN
PSQ01683 FD00012 Cathepsin L-like proteinase Q24940 Eukaryota Metazoa Spiralia Lophotrochozoa Platyhelminthes Trematoda Digenea Plagiorchiida Echinostomata Echinostomatoidea Fasciolidae Fasciola Fasciola hepatica (Liver fluke) 91 cysteine-type endopeptidase activity, endopeptidase activity 326 None Cat-1 6192 extracellular region proteolysis 8192668 91 16:106 SNDDLWHQWKRMYNKEYNGADDQHRRNIWEKNVKHIQEHNLRHDLGLVTYTLGLNQFTDMTFEEFKAKYLTEMSRASDILSHGVPYEANNR
PSQ01684 FD00472 Holotricin-2 Q25054 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Coleoptera Polyphaga Scarabaeiformia Scarabaeidae Melolonthinae Holotrichia Holotrichia diomphalia (Korean black chafer) 40 None 127 None None 33394 extracellular region defense response to bacterium, innate immune response 8188641 40 16:55 AYVVPVYYEIYPEDATFDEADIEPQLSPAELHHGSIRERR
PSQ01685 FD00568 Delta-latroinsectotoxin-Lt1a Q25338 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Arachnida Araneae Araneomorphae Entelegynae Araneoidea Theridiidae Latrodectus Latrodectus tredecimguttatus (Mediterranean black widow spider), (Latrodectus mactans tredecimguttatus) 278 toxin activity 1214 Delta-latroinsectotoxin None 6925 extracellular region, integral component of membrane, other organism cell membrane exocytosis 8631785 278 28:305 RDEEDGEMTLEERQAQCKAIEYSNSVFGMIADVANDIGSIPVIGEVVGIVTAPIAIVSHITSAGLDIASTALDCDDIPFDEIKEILEERFNEIDRKLDKNTAALEEVSKLVSKTFVTVEKTRNEMNENFKLVLETIESKEIKSIVFKINDFKKFFEKERQRIKGLPKDRYVAKLLEQKGILGSLKEVREPSGNSLSSALNELLDKNNNYAIPKVVDDNKAFQALYALFYGTQTYAAVMFFLLEQHSYLADYYYQKGDDVNFNAEFNNVAIIFDDFKSS
PSQ01686 FND00132 APGW-amide-related neuropeptide Q25461 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Bivalvia Autobranchia Pteriomorphia Mytiloida Mytiloidea Mytilidae Mytilinae Mytilus Mytilus edulis (Blue mussel) 26, 11, 11, 8, 15, 8, 35 None 196 None None 6550 None neuropeptide signaling pathway 8852595;8852595;8852595;8852595;8852595;8852595;8852595 114 23:48, 58:68, 78:88, 98:105, 115:129, 139:146, 162:196 SDESSERKKRDLDTIDDTNNDFLTAD, SFDDDILNNLD, SDMLFDSEEIE, SSSLYDDE, SSALLDDLSLYNSIV, SDTFKVDI, SGPNMCMDFQDEILQLYKLLNEAEKLHSECEALNI
PSQ01687 FD00003 Mu-conotoxin MrVIB Q26443 Eukaryota Metazoa Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae Conus Conus Conus marmoreus (Marble cone) 27 ion channel inhibitor activity, toxin activity 82 CGX-1002 None 42752 extracellular region pathogenesis 7622492, 7727394 27 23:49 DDSNNGLANHFLKSRDEMEDPEASKLE
PSQ01688 FD00047 M-myrmeciitoxin-Mp2a Q26464 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Hymenoptera Apocrita Aculeata Formicoidea Formicidae Myrmeciinae Myrmeciini Myrmecia Myrmecia pilosula (Jack jumper ant) (Australian jumper ant) 22 toxin activity 75 Allergen Myr p II , DELTA-myrtoxin-Mp1a A chain , Pilosin-3 subunit a , Pilosulin-2 None 13618 extracellular region defense response to bacterium, hemolysis in other organism 8605256 22 27:48 KALADPESDAVGFADAVGEADP
PSQ01689 FD00218 Microneme antigen Q26539 Eukaryota Sar Alveolata Apicomplexa Conoidasida Coccidia Eucoccidiorida Eimeriorina Sarcocystidae Sarcocystis Sarcocystis muris 69 carbohydrate binding 241 Lectin SML3 None 5813 cytoplasmic vesicle, extracellular region, microneme cell adhesion, proteolysis 8801555 69 35:103 AADALSWSGGLIHSPAHRVNVMRSHHHEMGKELEQQHGAEEQQMQRDTKPAAFSNPPHLATGRGPSFVH
PSQ01690 FD00012 Cathepsin L Q26636 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Brachycera Muscomorpha Oestroidea Sarcophagidae Sarcophaga Boettcherisca Sarcophaga peregrina (Flesh fly) (Boettcherisca peregrina) 104 cysteine-type endopeptidase activity 339 None None 7386 lysosome cell differentiation, multicellular organism development 8195162 104 18:121 ISPLDLIKEEWHTYKLQHRKNYANEVEERFRMKIFNENRHKIAKHNQLFAQGKVSYKLGLNKYADMLHHEFKETMNGYNHTLRQLMRERTGLVGATYIPPAHVT
PSQ01691 FD00213 Clotting factor B Q27081 Eukaryota Metazoa Ecdysozoa Arthropoda Chelicerata Merostomata Xiphosura Limulidae Tachypleus Tachypleus tridentatus (Japanese horseshoe crab) 21 endopeptidase activity, serine-type endopeptidase activity 400 Coagulation factor B None 6853 extracellular region hemolymph coagulation, protein processing 8407978 21 104:124 LPRLHISGCGKRKVKIDITTV
PSQ01692 FD00007 Chymotrypsin-1 Q27289 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Diptera Nematocera Culicoidea Culicidae Anophelinae Anopheles Anopheles gambiae (African malaria mosquito) 15 serine-type endopeptidase activity 259 AnChym1 CHYM1 7165 extracellular region digestion 11453997 15 18:32 AKVTKLVLDDNYVNR
PSQ01693 FD00073 Phenoloxidase subunit 1 Q27451 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Lepidoptera Glossata Ditrysia Bombycoidea Bombycidae Bombycinae Bombyx Bombyx mori (Silk moth) 51 metal ion binding, monophenol monooxygenase activity 685 PO 1, Tyrosinase 1 None 7091 extracellular region defense response, melanin biosynthetic process from tyrosine 7644494 51 1:51 MSDAKNNLLLFFDRPSEPCFMQKGEENAVFEIPDNYYPEKYQRVSNAIGNR
PSQ01694 FD00073 Phenoloxidase subunit 2 Q27452 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Lepidoptera Glossata Ditrysia Bombycoidea Bombycidae Bombycinae Bombyx Bombyx mori (Silk moth) 51 metal ion binding, monophenol monooxygenase activity 693 PO 2, Tyrosinase 2 None 7091 extracellular region defense response, melanin biosynthetic process from tyrosine 7644494 51 1:51 MADVFESLELLFDRPNEPLITPKGENNSVFQLTEQFLTEDYANNGIELNNR
PSQ01695 FD00159 Growth-blocking peptide Q27913 Eukaryota Metazoa Ecdysozoa Arthropoda Hexapoda Insecta Pterygota Neoptera Holometabola Lepidoptera Glossata Ditrysia Noctuoidea Noctuidae Hadeninae Mythimna Mythimna separata (Oriental armyworm) (Pseudaletia separata) 98 cytokine activity, growth factor activity 145 None None 271217 extracellular space hemocyte migration, positive regulation of cell division, regulation of synaptic transmission, dopaminergic 12182821, 2022627, 8580912 98 23:120 KLKDLFGKIHDSVHGTADKVKEDLNSLFHPNDKNQQGNNDASSNIHFADSEENTDAAKKPDEVTPATTTTTTAAPAVPNAPSDNPTTLAPSTTTKDGR
PSQ01696 FD00004 Venom plasminogen activator LV-PA Q27J47 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Lachesis Lachesis muta muta (Bushmaster) 6 serine-type endopeptidase activity, toxin activity 258 LMUT0402S, Plasminogen activating proteinase, Snake venom serine protease None 8753 extracellular region regulation of blood pressure 10871053, 17034951 6 19:24 QKSSKL
PSQ01697 FD00037 Bradykinin-potentiating and C-type natriuretic peptides Q27J49 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Lepidosauria Squamata Bifurcata Unidentata Episquamata Toxicofera Serpentes Colubroidea Viperidae Crotalinae Lachesis Lachesis muta muta (Bushmaster) 10, 7, 7, 28, 70 hormone activity, metalloendopeptidase inhibitor activity, toxin activity 240 BPP-CNP None 8753 extracellular region regulation of blood pressure, vasodilation 15876444;15876444;15876444;15876444, 16277978,;15876444, 16277978 122 24:33, 43:49, 76:82, 109:136, 148:217 KPVQQWSHKG, LVVQQWS, LVVQQWS, LLKPHESPAGGTTALREELSLGPEAALD, GSKAPAAPHRLPKSKGASATSAASRPMRDLRTDGKQARQNWGRMMNPDHHAVGGGGGGGGARRLKGLAKK
PSQ01698 FD00080 Guanylate cyclase activator 2B Q28358 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Metatheria Didelphimorphia Didelphidae Didelphis Didelphis virginiana (North American opossum) (Didelphis marsupialis, virginiana) 71 guanylate cyclase activator activity 109 None GUCA2B 9267 extracellular region None 7902563 71 24:94 VYIQYEGFQVKLDSVKKLDELLEQPRSFRHRMGTQRDPSVLCSDPALPSDLQPVCENSQAANIFRALRSIS
PSQ01699 FD00043 Pregnancy-associated glycoprotein 1 Q28755 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Caprinae Ovis Ovis aries (Sheep) 38 aspartic-type endopeptidase activity 382 Inactive aspartic protease PAG-1, Pregnancy-associated glycoprotein 66d None 9940 extracellular space None 15460157 38 16:53 IVKIPLRRVKTMRNTLSGKKMLNSFLKEHAYRLSQISF
PSQ01700 FD00522 Acrosin-binding protein Q29016 Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Laurasiatheria Artiodactyla Suina Suidae Sus Sus scrofa (Pig) 244 None 540 Acrosin-binding protein, Proacrosin-binding protein sp32 ACRBP 9823 acrosomal membrane, acrosomal vesicle, extracellular region acrosome assembly, fertilization, sperm capacitation 8144514 244 26:269 QDANSASTPGSPLSPTEYERFFALLTPTWKAETTCRLRATHGCRNPTLVQLDQYENHGLVPDGAVCSDLPYASWFESFCQFTQYRCSNHVYYAKRVRCSQPVSILSPNSLKEVDTSSEVPITTMTSPVSSHITATGRQVFQPWPERLNNNVEELLQSSLSLGGQEQGQEHKQEHKQEQGQEHKQDEGQEQEEQEEEQEEEGKQEEGQGTEESLEAMSGLQADSEPKFQSEFVSSNPFSFTPRVR
Total Pages 43
Go to Lab Web Page