ProSeqID	PSQ01624
Family	FD00594
Protein Name	Protein lgg-1
UniProt ID	Q09490
Taxonomy	Eukaryota-Metazoa-Ecdysozoa-Nematoda-Chromadorea-Rhabditida-Rhabditina-Rhabditomorpha-Rhabditoidea-Rhabditidae-Peloderinae-Caenorhabditis
Organisms	Caenorhabditis elegans
Prosequence Length (aa)	7
Functions	GABA receptor binding, ubiquitin protein ligase binding
Preproprotein Length (aa)	123
Alt Name	None
Gene Name	lgg-1
NCBI ID	6239
Cellular Localization	autophagosome, autophagosome membrane, cytoplasm, cytosol, dendrite, lysosomal lumen, mitochondrial outer membrane, neuron projection, neuronal cell body, nucleus, perikaryon, phagocytic vesicle membrane, phagophore assembly site, plasma membrane
Processes	autophagosome assembly, autophagy, autophagy of mitochondrion, cellular response to nitrogen starvation, dauer larval development, defense response to Gram-positive bacterium, determination of adult lifespan, macroautophagy, plasma membrane repair, positive regulation of autophagosome assembly, positive regulation of necrotic cell death, programmed cell death, xenophagy
PubMed	20550938, 21802374
Total Prosequence Length (aa)	7
Prosequence Location	117:123
Prosequence Sequence	GEVEKKE
Preproprotein Sequence	MKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVGQFYFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYGGEVEKKE