Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01623

ProSeqID PSQ01623
Family FND00220
Protein Name Pro-P-factor
UniProt ID Q09180
Taxonomy Eukaryota-Fungi-Dikarya-Ascomycota-Taphrinomycotina-Schizosaccharomycetes-Schizosaccharomycetales-Schizosaccharomycetaceae-Schizosaccharomyces
Organisms Schizosaccharomyces pombe (strain 972
Prosequence Length (aa) 8
Functions mating pheromone activity
Preproprotein Length (aa) 201
Alt Name None
Gene Name map2
NCBI ID 284812
Cellular Localization cell surface, extracellular region
Processes cell cycle, cell-cell signaling, induction of conjugation upon nitrogen starvation, induction of conjugation with cellular fusion, positive regulation of pheromone response MAPK cascade, regulation of cell cycle switching, mitotic to meiotic cell cycle, signal transduction involved in positive regulation of conjugation with cellular fusion
PubMed 8314086
Total Prosequence Length (aa) 8
Prosequence Location 58:65
Prosequence Sequence EFEAAPAK
Preproprotein Sequence MKITAVIALLFSLAAASPIPVADPGVVSVSKSYADFLRVYQSWNTFANPDRPNLKKREFEAAPAKTYADFLRAYQSWNTFVNPDRPNLKKREFEAAPEKSYADFLRAYHSWNTFVNPDRPNLKKREFEAAPAKTYADFLRAYQSWNTFVNPDRPNLKKRTEEDEENEEEDEEYYRFLQFYIMTVPENSTITDVNITAKFES