Details of PSQ01643
ProSeqID |
PSQ01643 |
Family |
FD00224 |
Protein Name |
Disintegrin and metalloproteinase domain-containing protein 10 |
UniProt ID |
Q10741
|
Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Laurasiatheria-Artiodactyla-Ruminantia-Pecora-Bovidae-Bovinae-Bos |
Organisms |
Bos taurus (Bovine) |
Prosequence Length (aa) |
194 |
Functions |
endopeptidase activity, metal ion binding, metalloendopeptidase activity, metalloendopeptidase activity involved in amyloid precursor protein catabolic process, metallopeptidase activity, protein homodimerization activity, protein kinase binding, SH3 domain binding |
Preproprotein Length (aa) |
748 |
Alt Name |
Kuzbanian protein homolog, Mammalian disintegrin-metalloprotease, Myelin-associated metalloproteinase |
Gene Name |
ADAM10 |
NCBI ID |
9913 |
Cellular Localization |
adherens junction, axon, cell surface, clathrin-coated vesicle, cytoplasm, dendrite, glutamatergic synapse, Golgi apparatus, Golgi membrane, Golgi-associated vesicle, nucleus, perinuclear endoplasmic reticulum, plasma membrane, pore complex, postsynaptic density, synaptic membrane, tetraspanin-enriched microdomain |
Processes |
adherens junction organization, amyloid precursor protein catabolic process, cochlea development, constitutive protein ectodomain proteolysis, in utero embryonic development, membrane protein ectodomain proteolysis, monocyte activation, negative regulation of cell adhesion, negative regulation of gene expression, Notch signaling pathway, pore complex assembly, positive regulation of cell growth, positive regulation of cell population proliferation, positive regulation of T cell chemotaxis, postsynapse organization, protein phosphorylation, protein processing, regulation of neurotransmitter receptor localization to postsynaptic specialization membrane, regulation of Notch signaling pathway, regulation of vasculature development, response to tumor necrosis factor, toxin transport |
PubMed |
10097139,
11481247
|
Total Prosequence Length (aa) |
194 |
Prosequence Location |
20:213 |
Prosequence Sequence |
QYGNPLNKYIRHYEGLSYDVDSLHQKHQRAKRAVSHEDQFLRLDFHAHGRHFNLRMKRDTSLFSEEFRVETSNAVLDYDTSHIYTGHIYGEEGSFSHGSVIDGRFEGFIQTHGGTFYVEPAERYIKDRTLPFHSVIYHEDDIKYPHKYGPQGGCADHSVFERMRKYQMTGVEEVTQTPQEKHAINGPELLRKKR |
Preproprotein Sequence |
MVLLRVLILLLSWVAGLGGQYGNPLNKYIRHYEGLSYDVDSLHQKHQRAKRAVSHEDQFLRLDFHAHGRHFNLRMKRDTSLFSEEFRVETSNAVLDYDTSHIYTGHIYGEEGSFSHGSVIDGRFEGFIQTHGGTFYVEPAERYIKDRTLPFHSVIYHEDDIKYPHKYGPQGGCADHSVFERMRKYQMTGVEEVTQTPQEKHAINGPELLRKKRTTVAEKNTCQLYIQTDHLFFKYYGTREAVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTTADEKDPTNPFRFPNIGVEKFLELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCYDANQPEGKKCKLKPGKQCSPSQGPCCTAHCAFKSKTEKCRDDSDCAKEGICNGITALCPASDPKPNFTDCNRHTQVCINGQCAGSICEKHGLEECTCASSDGKDDKELCHVCCMKKMEPSTCASTGSVQWNKYFLGRTITLQPGSPCNDFRGYCDVFMRCRLVDADGPLARLKKAIFSPELYENIAEWIVAYWWAVLLMGIALIMLMAGFIKICSVHTPSSNPKLPPPKPLPGTLKRRRPPQPIQQPQRQRPRESYQMGHMRR |