Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01643

ProSeqID PSQ01643
Family FD00224
Protein Name Disintegrin and metalloproteinase domain-containing protein 10
UniProt ID Q10741
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Laurasiatheria-Artiodactyla-Ruminantia-Pecora-Bovidae-Bovinae-Bos
Organisms Bos taurus (Bovine)
Prosequence Length (aa) 194
Functions endopeptidase activity, metal ion binding, metalloendopeptidase activity, metalloendopeptidase activity involved in amyloid precursor protein catabolic process, metallopeptidase activity, protein homodimerization activity, protein kinase binding, SH3 domain binding
Preproprotein Length (aa) 748
Alt Name Kuzbanian protein homolog, Mammalian disintegrin-metalloprotease, Myelin-associated metalloproteinase
Gene Name ADAM10
NCBI ID 9913
Cellular Localization adherens junction, axon, cell surface, clathrin-coated vesicle, cytoplasm, dendrite, glutamatergic synapse, Golgi apparatus, Golgi membrane, Golgi-associated vesicle, nucleus, perinuclear endoplasmic reticulum, plasma membrane, pore complex, postsynaptic density, synaptic membrane, tetraspanin-enriched microdomain
Processes adherens junction organization, amyloid precursor protein catabolic process, cochlea development, constitutive protein ectodomain proteolysis, in utero embryonic development, membrane protein ectodomain proteolysis, monocyte activation, negative regulation of cell adhesion, negative regulation of gene expression, Notch signaling pathway, pore complex assembly, positive regulation of cell growth, positive regulation of cell population proliferation, positive regulation of T cell chemotaxis, postsynapse organization, protein phosphorylation, protein processing, regulation of neurotransmitter receptor localization to postsynaptic specialization membrane, regulation of Notch signaling pathway, regulation of vasculature development, response to tumor necrosis factor, toxin transport
PubMed 10097139, 11481247
Total Prosequence Length (aa) 194
Prosequence Location 20:213
Prosequence Sequence QYGNPLNKYIRHYEGLSYDVDSLHQKHQRAKRAVSHEDQFLRLDFHAHGRHFNLRMKRDTSLFSEEFRVETSNAVLDYDTSHIYTGHIYGEEGSFSHGSVIDGRFEGFIQTHGGTFYVEPAERYIKDRTLPFHSVIYHEDDIKYPHKYGPQGGCADHSVFERMRKYQMTGVEEVTQTPQEKHAINGPELLRKKR
Preproprotein Sequence MVLLRVLILLLSWVAGLGGQYGNPLNKYIRHYEGLSYDVDSLHQKHQRAKRAVSHEDQFLRLDFHAHGRHFNLRMKRDTSLFSEEFRVETSNAVLDYDTSHIYTGHIYGEEGSFSHGSVIDGRFEGFIQTHGGTFYVEPAERYIKDRTLPFHSVIYHEDDIKYPHKYGPQGGCADHSVFERMRKYQMTGVEEVTQTPQEKHAINGPELLRKKRTTVAEKNTCQLYIQTDHLFFKYYGTREAVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTTADEKDPTNPFRFPNIGVEKFLELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCYDANQPEGKKCKLKPGKQCSPSQGPCCTAHCAFKSKTEKCRDDSDCAKEGICNGITALCPASDPKPNFTDCNRHTQVCINGQCAGSICEKHGLEECTCASSDGKDDKELCHVCCMKKMEPSTCASTGSVQWNKYFLGRTITLQPGSPCNDFRGYCDVFMRCRLVDADGPLARLKKAIFSPELYENIAEWIVAYWWAVLLMGIALIMLMAGFIKICSVHTPSSNPKLPPPKPLPGTLKRRRPPQPIQQPQRQRPRESYQMGHMRR