Details of PSQ01633
| ProSeqID |
PSQ01633 |
| Family |
FD00018 |
| Protein Name |
Disintegrin jarastatin |
| UniProt ID |
Q0NZX5
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Lepidosauria-Squamata-Bifurcata-Unidentata-Episquamata-Toxicofera-Serpentes-Colubroidea-Viperidae-Crotalinae-Bothrops |
| Organisms |
Bothrops jararaca (Jararaca) (Bothrops jajaraca) |
| Prosequence Length (aa) |
15 |
| Functions |
toxin activity |
| Preproprotein Length (aa) |
88 |
| Alt Name |
Platelet aggregation activation inhibitor |
| Gene Name |
None |
| NCBI ID |
8724 |
| Cellular Localization |
extracellular region |
| Processes |
apoptotic process, chemotaxis |
| PubMed |
10471323
|
| Total Prosequence Length (aa) |
15 |
| Prosequence Location |
1:15 |
| Prosequence Sequence |
RTDTVSTPVSGNELL |
| Preproprotein Sequence |
RTDTVSTPVSGNELLEAGEECDCGTPGNPCCDAATCKLRPGAQCAEGLCCDQCRFMKEGTVCRRARGDDMDDYCNGISAGCPRNPFHA |