Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01607

ProSeqID PSQ01607
Family FD00104
Protein Name Regenerating islet-derived protein 3-alpha
UniProt ID Q06141
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo
Organisms Homo sapiens (Human)
Prosequence Length (aa) 11
Functions carbohydrate binding, identical protein binding, oligosaccharide binding, peptidoglycan binding, signaling receptor activity
Preproprotein Length (aa) 180
Alt Name Hepatointestinal pancreatic protein, Human proislet peptide, Pancreatitis-associated protein 1, Regenerating islet-derived protein III-alpha
Gene Name REG3A
NCBI ID 9606
Cellular Localization cytoplasm, extracellular region, extracellular space
Processes acute-phase response, antimicrobial humoral immune response mediated by antimicrobial peptide, antimicrobial humoral response, cell wall disruption in other organism, heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules, negative regulation of keratinocyte differentiation, positive regulation of cell population proliferation, positive regulation of keratinocyte proliferation, positive regulation of wound healing, response to peptide hormone
PubMed 19254208
Total Prosequence Length (aa) 11
Prosequence Location 27:37
Prosequence Sequence EEPQRELPSAR
Preproprotein Sequence MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD