Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ02050

ProSeqID PSQ02050
Family FD00004
Protein Name Kallikrein-14
UniProt ID Q9P0G3
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo
Organisms Homo sapiens (Human)
Prosequence Length (aa) 6
Functions serine-type endopeptidase activity
Preproprotein Length (aa) 267
Alt Name Kallikrein-like protein 6
Gene Name KLK14
NCBI ID 9606
Cellular Localization extracellular region, extracellular space, secretory granule
Processes cornification, epidermis morphogenesis, fertilization, negative regulation of G protein-coupled receptor signaling pathway, positive regulation of G protein-coupled receptor signaling pathway, proteolysis, seminal clot liquefaction
PubMed 16800737
Total Prosequence Length (aa) 6
Prosequence Location 35:40
Prosequence Sequence QEDENK
Preproprotein Sequence MSLRVLGSGTWPSAPKMFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGGALLSGQWVITAAHCGRPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQCVNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWIEETMRDK