Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ02033

ProSeqID PSQ02033
Family FD00050
Protein Name Interleukin-36 alpha
UniProt ID Q9JLA2
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Mus-Mus
Organisms Mus musculus (Mouse)
Prosequence Length (aa) 7
Functions cytokine activity, interleukin-1 receptor binding
Preproprotein Length (aa) 160
Alt Name FIL1 epsilon, Interleukin-1 epsilon, Interleukin-1 family member 6, Interleukin-1 homolog 1
Gene Name Il36a
NCBI ID 10090
Cellular Localization cytoplasm, extracellular space
Processes cellular response to lipopolysaccharide, cytokine-mediated signaling pathway, inflammatory response, inflammatory response to antigenic stimulus, innate immune response, positive regulation of cytokine production, positive regulation of gene expression, positive regulation of interleukin-6 production
PubMed 21965679
Total Prosequence Length (aa) 7
Prosequence Location 1:7
Prosequence Sequence MNKEKEL
Preproprotein Sequence MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH