Details of PSQ02016
| ProSeqID |
PSQ02016 |
| Family |
FD00324 |
| Protein Name |
Metalloendopeptidase OMA1 |
| UniProt ID |
Q9D8H7
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Mus-Mus |
| Organisms |
Mus musculus (Mouse) |
| Prosequence Length (aa) |
60 |
| Functions |
lipid binding, metal ion binding, metalloendopeptidase activity |
| Preproprotein Length (aa) |
521 |
| Alt Name |
Overlapping with the m-AAA protease 1 homolog |
| Gene Name |
Oma1 |
| NCBI ID |
10090 |
| Cellular Localization |
integral component of membrane, mitochondrial inner membrane, mitochondrial membrane, mitochondrion |
| Processes |
cristae formation, diet induced thermogenesis, energy homeostasis, glucose metabolic process, HRI-mediated signaling, integrated stress response signaling, lipid metabolic process, mitochondrial protein processing, mitochondrial respiratory chain complex assembly, mitochondrion organization, negative regulation of mitochondrial fusion, positive regulation of apoptotic process, positive regulation of cold-induced thermogenesis, protein autoprocessing, protein quality control for misfolded or incompletely synthesized proteins, regulation of cristae formation, zymogen activation |
| PubMed |
24550258
|
| Total Prosequence Length (aa) |
60 |
| Prosequence Location |
80:139 |
| Prosequence Sequence |
SSAQSKELGVLTYRCTVRGDSVLRQGARKVAGVPALAASCSPSCPAVIEARSFRTSARVQ |
| Preproprotein Sequence |
MSLLYGLQSTRINRFLSGVNNLANRRQWTPPASCPLAPKLRAVNAYWGLNTVSHCHSVTLLPRNFLFCRTLNHKKSRCLSSAQSKELGVLTYRCTVRGDSVLRQGARKVAGVPALAASCSPSCPAVIEARSFRTSARVQAAPVPLLLLILKPVQKLLAIIVGRGIRKWWQALPPNKKELFKDSVRKNKWRLLLGLSAFGLLFVVFYFTHLEVSPVTGRSKLLLVGKEHFRLLSDLEYEVWMEEFKNDLLPERDPRYLTVKEMVYHLTQCNRDVPGISETNWVVHVVDSPAVNAFVLPNGQVFIFTGLLNSVTDVHQLSFLLGHEIAHAVLGHAAEKASLVHLLDFLGMIFLTMIWAICPRDSLAVLGQWIQSKLQEYMFDRPYSRTLEAEADKVGLQLAAKACADVRASSVFWQQMEFSESLHGYPKLPEWLSTHPSHGNRAEYLDRLIPQALKLREVCNCPPLSGPDPRLLFRLTVKRFLEDSEKEDLNITVKKQKTDALPMQKQEQIPLTYVLEKRTAG |
