Details of PSQ02048
| ProSeqID |
PSQ02048 |
| Family |
FD00050 |
| Protein Name |
Interleukin-37 |
| UniProt ID |
Q9NZH6
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo |
| Organisms |
Homo sapiens (Human) |
| Prosequence Length (aa) |
45 |
| Functions |
cytokine activity, interleukin-1 receptor binding |
| Preproprotein Length (aa) |
218 |
| Alt Name |
FIL1 zeta, IL-1X, Interleukin-1 family member 7, Interleukin-1 homolog 4, Interleukin-1 zeta, Interleukin-1-related protein, Interleukin-23 |
| Gene Name |
IL37 |
| NCBI ID |
9606 |
| Cellular Localization |
cytosol, extracellular region, extracellular space, intracellular membrane-bounded organelle, nucleoplasm |
| Processes |
cellular response to cytokine stimulus, cellular response to lipopolysaccharide, cytokine-mediated signaling pathway, immune response, inflammatory response, inflammatory response to antigenic stimulus, negative regulation of interleukin-6 production, negative regulation of tumor necrosis factor production, positive regulation of gene expression, regulation of inflammatory response |
| PubMed |
11145836
|
| Total Prosequence Length (aa) |
45 |
| Prosequence Location |
1:45 |
| Prosequence Sequence |
MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNF |
| Preproprotein Sequence |
MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD |
