Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ02022

ProSeqID PSQ02022
Family FD00072
Protein Name Photosystem II reaction center protein K
UniProt ID Q9F1K9
Taxonomy Bacteria-Cyanobacteria-Synechococcales-Synechococcaceae-Thermosynechococcus
Organisms Thermosynechococcus elongatus (strain BP-1)
Prosequence Length (aa) 9
Functions None
Preproprotein Length (aa) 46
Alt Name None
Gene Name psbK
NCBI ID 197221
Cellular Localization integral component of membrane, photosystem II reaction center, plasma membrane-derived thylakoid membrane
Processes photosynthesis
PubMed 17935689, 17967798
Total Prosequence Length (aa) 9
Prosequence Location 1:9
Prosequence Sequence MIDALVLVA
Preproprotein Sequence MIDALVLVAKLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR