Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ02002

ProSeqID PSQ02002
Family FD00130
Protein Name Augurin
UniProt ID Q99LS0
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Mus-Mus
Organisms Mus musculus (Mouse)
Prosequence Length (aa) 39
Functions neuropeptide hormone activity
Preproprotein Length (aa) 148
Alt Name Esophageal cancer-related gene 4 protein homolog
Gene Name Ecrg4
NCBI ID 10090
Cellular Localization apical plasma membrane, cytoplasm, dense core granule, extracellular space
Processes anaphase-promoting complex-dependent catabolic process, cellular senescence, central nervous system development, G1 to G0 transition, negative regulation of cell population proliferation, neuropeptide signaling pathway, positive regulation of corticosterone secretion, positive regulation of corticotropin secretion, positive regulation of corticotropin-releasing hormone secretion, regulation of cell population proliferation, response to wounding, vasopressin secretion
PubMed 17284679
Total Prosequence Length (aa) 39
Prosequence Location 32:70
Prosequence Sequence NKLKKMLQKREGPVPSKTNVAVAENTAKEFLGGLKRAKR
Preproprotein Sequence MSTSSARPAVLALAGLALLLLLCLGPDGISGNKLKKMLQKREGPVPSKTNVAVAENTAKEFLGGLKRAKRQLWDRTRPEVQQWYQQFLYMGFDEAKFEDDVNYWLNRNRNGHDYYGDYYQRHYDEDAAIGPHSRESFRHGASVNYNDY