Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ02049

ProSeqID PSQ02049
Family FD00050
Protein Name Interleukin-36 gamma
UniProt ID Q9NZH8
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo
Organisms Homo sapiens (Human)
Prosequence Length (aa) 17
Functions cytokine activity, interleukin-1 receptor binding
Preproprotein Length (aa) 169
Alt Name IL-1-related protein 2, Interleukin-1 epsilon, Interleukin-1 family member 9, Interleukin-1 homolog 1
Gene Name IL36G
NCBI ID 9606
Cellular Localization cytoplasm, extracellular region, extracellular space
Processes cell-cell signaling, cellular response to lipopolysaccharide, cytokine-mediated signaling pathway, inflammatory response, inflammatory response to antigenic stimulus, innate immune response, positive regulation of gene expression
PubMed 21965679
Total Prosequence Length (aa) 17
Prosequence Location 1:17
Prosequence Sequence MRGTPGDADGGGRAVYQ
Preproprotein Sequence MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND