Details of PSQ01094
| ProSeqID |
PSQ01094 |
| Family |
FD00339 |
| Protein Name |
Ganglioside GM2 activator |
| UniProt ID |
P17900
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo |
| Organisms |
Homo sapiens (Human) |
| Prosequence Length (aa) |
8 |
| Functions |
beta-N-acetylgalactosaminidase activity, lipid transporter activity, phospholipase activator activity |
| Preproprotein Length (aa) |
193 |
| Alt Name |
Cerebroside sulfate activator protein, GM2-AP, Sphingolipid activator protein 3 |
| Gene Name |
GM2A |
| NCBI ID |
9606 |
| Cellular Localization |
apical plasma membrane, azurophil granule lumen, basolateral plasma membrane, cytoplasmic side of plasma membrane, cytosol, extracellular exosome, extracellular region, intracellular membrane-bounded organelle, lysosomal lumen |
| Processes |
ganglioside catabolic process, glycosphingolipid metabolic process, learning or memory, lipid storage, lipid transport, neuromuscular process controlling balance, neutrophil degranulation, oligosaccharide catabolic process, positive regulation of hydrolase activity |
| PubMed |
2209618
|
| Total Prosequence Length (aa) |
8 |
| Prosequence Location |
24:31 |
| Prosequence Sequence |
HLKKPSQL |
| Preproprotein Sequence |
MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI |
