Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01051

ProSeqID PSQ01051
Family FD00328
Protein Name Oncostatin-M
UniProt ID P13725
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo
Organisms Homo sapiens (Human)
Prosequence Length (aa) 31
Functions cytokine activity, growth factor activity, oncostatin-M receptor binding
Preproprotein Length (aa) 252
Alt Name None
Gene Name OSM
NCBI ID 9606
Cellular Localization extracellular region, extracellular space
Processes cytokine-mediated signaling pathway, immune response, multicellular organism development, negative regulation of cell population proliferation, negative regulation of hormone secretion, oncostatin-M-mediated signaling pathway, positive regulation of acute inflammatory response, positive regulation of cell division, positive regulation of cell population proliferation, positive regulation of inflammatory response, positive regulation of interleukin-17 production, positive regulation of MAPK cascade, positive regulation of peptidyl-serine phosphorylation, positive regulation of peptidyl-tyrosine phosphorylation, positive regulation of phosphatidylinositol 3-kinase signaling, positive regulation of protein kinase B signaling, positive regulation of transcription by RNA polymerase II, positive regulation of tyrosine phosphorylation of STAT protein, regulation of growth, regulation of hematopoietic stem cell differentiation
PubMed 2325640
Total Prosequence Length (aa) 31
Prosequence Location 222:252
Prosequence Sequence HSPHQALRKGVRRTRPSRKGKRLMTRGQLPR
Preproprotein Sequence MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR