ProSeqID | PSQ01051 |
Family | FD00328 |
Protein Name | Oncostatin-M |
UniProt ID | P13725 |
Taxonomy | Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo |
Organisms | Homo sapiens (Human) |
Prosequence Length (aa) | 31 |
Functions | cytokine activity, growth factor activity, oncostatin-M receptor binding |
Preproprotein Length (aa) | 252 |
Alt Name | None |
Gene Name | OSM |
NCBI ID | 9606 |
Cellular Localization | extracellular region, extracellular space |
Processes | cytokine-mediated signaling pathway, immune response, multicellular organism development, negative regulation of cell population proliferation, negative regulation of hormone secretion, oncostatin-M-mediated signaling pathway, positive regulation of acute inflammatory response, positive regulation of cell division, positive regulation of cell population proliferation, positive regulation of inflammatory response, positive regulation of interleukin-17 production, positive regulation of MAPK cascade, positive regulation of peptidyl-serine phosphorylation, positive regulation of peptidyl-tyrosine phosphorylation, positive regulation of phosphatidylinositol 3-kinase signaling, positive regulation of protein kinase B signaling, positive regulation of transcription by RNA polymerase II, positive regulation of tyrosine phosphorylation of STAT protein, regulation of growth, regulation of hematopoietic stem cell differentiation |
PubMed | 2325640 |
Total Prosequence Length (aa) | 31 |
Prosequence Location | 222:252 |
Prosequence Sequence | HSPHQALRKGVRRTRPSRKGKRLMTRGQLPR |
Preproprotein Sequence | MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR |