Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01096

ProSeqID PSQ01096
Family FD00535
Protein Name Bone morphogenetic protein 7
UniProt ID P18075
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo
Organisms Homo sapiens (Human)
Prosequence Length (aa) 263
Functions BMP receptor binding, cytokine activity, growth factor activity, heparin binding
Preproprotein Length (aa) 431
Alt Name Osteogenic protein 1
Gene Name BMP7
NCBI ID 9606
Cellular Localization collagen-containing extracellular matrix, extracellular region, extracellular space, vesicle
Processes allantois development, axon guidance, BMP signaling pathway, branching involved in salivary gland morphogenesis, branching morphogenesis of an epithelial tube, cardiac muscle tissue development, cardiac septum morphogenesis, cartilage development, cellular response to BMP stimulus, cellular response to hypoxia, chorio-allantoic fusion, dendrite development, embryonic camera-type eye morphogenesis, embryonic limb morphogenesis, embryonic pattern specification, embryonic skeletal joint morphogenesis, endocardial cushion formation, epithelial cell differentiation, epithelial to mesenchymal transition, heart trabecula morphogenesis, hindbrain development, mesenchymal cell differentiation, mesenchyme development, mesoderm formation, mesonephros development, metanephric mesenchymal cell proliferation involved in metanephros development, metanephric mesenchyme morphogenesis, metanephros development, monocyte aggregation, negative regulation of cell cycle, negative regulation of cell death, negative regulation of glomerular mesangial cell proliferation, negative regulation of MAP kinase activity, negative regulation of mesenchymal cell apoptotic process involved in nephron morphogenesis, negative regulation of mitotic nuclear division, negative regulation of neurogenesis, negative regulation of neuron differentiation, negative regulation of NF-kappaB transcription factor activity, negative regulation of NIK/NF-kappaB signaling, negative regulation of Notch signaling pathway, negative regulation of phosphorylation, negative regulation of prostatic bud formation, negative regulation of striated muscle cell apoptotic process, negative regulation of transcription, DNA-templated, nephrogenic mesenchyme morphogenesis, neural fold elevation formation, neuron projection morphogenesis, odontogenesis of dentin-containing tooth, ossification, pericardium morphogenesis, pharyngeal system development, positive regulation of apoptotic process, positive regulation of bone mineralization, positive regulation of brown fat cell differentiation, positive regulation of cardiac neural crest cell migration involved in outflow tract morphogenesis, positive regulation of dendrite development, positive regulation of epithelial to mesenchymal transition, positive regulation of gene expression, positive regulation of heterotypic cell-cell adhesion, positive regulation of hyaluranon cable assembly, positive regulation of neuron differentiation, positive regulation of osteoblast differentiation, positive regulation of pathway-restricted SMAD protein phosphorylation, positive regulation of peptidyl-threonine phosphorylation, positive regulation of transcription by RNA polymerase II, positive regulation of transcription, DNA-templated, protein localization to nucleus, regulation of branching involved in prostate gland morphogenesis, regulation of pathway-restricted SMAD protein phosphorylation, regulation of removal of superoxide radicals, response to estradiol, response to peptide hormone, response to vitamin D, skeletal system development, SMAD protein signal transduction, steroid hormone mediated signaling pathway, ureteric bud development
PubMed 17977014
Total Prosequence Length (aa) 263
Prosequence Location 30:292
Prosequence Sequence DFSLDNEVHSSFIHRRLRSQERREMQREILSILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNETFRISVYQVLQEHLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPRHNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHFRSIR
Preproprotein Sequence MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILSILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNETFRISVYQVLQEHLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPRHNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHFRSIRSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH