Details of PSQ01084
| ProSeqID |
PSQ01084 |
| Family |
FD00394 |
| Protein Name |
Dipeptidase 1 |
| UniProt ID |
P16444
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo |
| Organisms |
Homo sapiens (Human) |
| Prosequence Length (aa) |
26 |
| Functions |
beta-lactamase activity, cysteine-type endopeptidase inhibitor activity involved in apoptotic process, GPI anchor binding, metallodipeptidase activity, metalloexopeptidase activity, modified amino acid binding, zinc ion binding |
| Preproprotein Length (aa) |
418 |
| Alt Name |
Beta-lactamase , Dehydropeptidase-I, Microsomal dipeptidase , Renal dipeptidase |
| Gene Name |
DPEP1 |
| NCBI ID |
9606 |
| Cellular Localization |
anchored component of membrane, apical part of cell, apical plasma membrane, cell junction, extracellular exosome, extracellular space, microvillus membrane, nucleoplasm, plasma membrane |
| Processes |
aflatoxin metabolic process, antibiotic metabolic process, cellular lactam catabolic process, cellular response to calcium ion, cellular response to drug, cellular response to nitric oxide, glutathione catabolic process, glutathione metabolic process, homocysteine metabolic process, inflammatory response, leukotriene metabolic process, lipid metabolic process, negative regulation of apoptotic process, negative regulation of cell migration, negative regulation of cysteine-type endopeptidase activity involved in apoptotic process, negative regulation of inflammatory response to antigenic stimulus, neutrophil chemotaxis |
| PubMed |
2168407
|
| Total Prosequence Length (aa) |
26 |
| Prosequence Location |
386:411 |
| Prosequence Sequence |
GASSLHRHWGLLLASLAPLVLCLSLL |
| Preproprotein Sequence |
MWSGWWLWPLVAVCTADFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSSGASSLHRHWGLLLASLAPLVLCLSLL |
