Details of PSQ01054
| ProSeqID |
PSQ01054 |
| Family |
FD00547 |
| Protein Name |
CD59 glycoprotein |
| UniProt ID |
P13987
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Primates-Haplorrhini-Catarrhini-Hominidae-Homo |
| Organisms |
Homo sapiens (Human) |
| Prosequence Length (aa) |
26 |
| Functions |
complement binding |
| Preproprotein Length (aa) |
128 |
| Alt Name |
1F5 antigen, 20 kDa homologous restriction factor, MAC-inhibitory protein, MEM43 antigen, Membrane attack complex inhibition factor, Membrane inhibitor of reactive lysis, Protectin |
| Gene Name |
CD59 |
| NCBI ID |
9606 |
| Cellular Localization |
anchored component of external side of plasma membrane, cell surface, endoplasmic reticulum membrane, endoplasmic reticulum-Golgi intermediate compartment membrane, ER to Golgi transport vesicle membrane, extracellular exosome, extracellular space, focal adhesion, Golgi membrane, membrane, plasma membrane, specific granule membrane, tertiary granule membrane, transport vesicle, vesicle |
| Processes |
blood coagulation, cell surface receptor signaling pathway, COPII vesicle coating, endoplasmic reticulum to Golgi vesicle-mediated transport, negative regulation of activation of membrane attack complex, neutrophil degranulation, regulation of complement activation, regulation of complement-dependent cytotoxicity |
| PubMed |
9054419
|
| Total Prosequence Length (aa) |
26 |
| Prosequence Location |
103:128 |
| Prosequence Sequence |
GGTSLSEKTVLLLVTPFLAAAWSLHP |
| Preproprotein Sequence |
MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP |
