Details of PSQ01671
| ProSeqID |
PSQ01671 |
| Family |
FD00059 |
| Protein Name |
M-zodatoxin-Lt5a |
| UniProt ID |
Q1ELU9
|
| Taxonomy |
Eukaryota-Metazoa-Ecdysozoa-Arthropoda-Chelicerata-Arachnida-Araneae-Araneomorphae-Entelegynae-Entelegynae-Incertae-Sedis-Zodariidae-Lachesana |
| Organisms |
Lachesana tarabaevi (Spider) |
| Prosequence Length (aa) |
42 |
| Functions |
toxin activity |
| Preproprotein Length (aa) |
93 |
| Alt Name |
Latarcin-5 |
| Gene Name |
None |
| NCBI ID |
379576 |
| Cellular Localization |
extracellular region |
| Processes |
defense response to bacterium, defense response to fungus, hemolysis in other organism |
| PubMed |
16735513
|
| Total Prosequence Length (aa) |
42 |
| Prosequence Location |
23:64 |
| Prosequence Sequence |
TETGYAVAETLEDNDLDELQAYLEEIAEASEMEDFSNIEEAR |
| Preproprotein Sequence |
MKYCVVILALLVALVCITESRSTETGYAVAETLEDNDLDELQAYLEEIAEASEMEDFSNIEEARGFFGKMKEYFKKFGASFKRRFANLKKRLG |