Details of PSQ01662
| ProSeqID |
PSQ01662 |
| Family |
FD00048 |
| Protein Name |
Osteocalcin 1 |
| UniProt ID |
Q1EG28
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Actinopterygii-Neopterygii-Teleostei-Neoteleostei-Acanthomorphata-Carangaria-Pleuronectiformes-Pleuronectoidei-Soleidae-Solea |
| Organisms |
Solea senegalensis (Senegalese sole) |
| Prosequence Length (aa) |
29 |
| Functions |
calcium ion binding |
| Preproprotein Length (aa) |
95 |
| Alt Name |
Bone Gla protein , Gamma-carboxyglutamic acid-containing protein |
| Gene Name |
bglapBGP |
| NCBI ID |
28829 |
| Cellular Localization |
extracellular region |
| Processes |
biomineral tissue development, bone development, regulation of cellular response to insulin stimulus, response to vitamin K |
| PubMed |
24185858
|
| Total Prosequence Length (aa) |
29 |
| Prosequence Location |
22:50 |
| Prosequence Sequence |
SFSSQPAVDTPAQEGLFVEQEQASSVVRQ |
| Preproprotein Sequence |
MKTLSVLVLCSLAVLCLTSDASFSSQPAVDTPAQEGLFVEQEQASSVVRQAPKELSLSQLESLREVCELNLACEDMMDTSGIIAAYTTYYGPIPF |