Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01581

ProSeqID PSQ01581
Family FD00453
Protein Name Type II secretion system protein I
UniProt ID Q00516
Taxonomy Bacteria-Proteobacteria-Gammaproteobacteria-Pseudomonadales-Pseudomonadaceae-Pseudomonas
Organisms Pseudomonas aeruginosa (strain ATCC 15692 , 14847
Prosequence Length (aa) 6
Functions None
Preproprotein Length (aa) 129
Alt Name General secretion pathway protein I, PilD-dependent protein PddC
Gene Name xcpV
NCBI ID 208964
Cellular Localization integral component of membrane, plasma membrane, type II protein secretion system complex
Processes protein secretion by the type II secretion system
PubMed 8331069
Total Prosequence Length (aa) 6
Prosequence Location 1:6
Prosequence Sequence MKRARG
Preproprotein Sequence MKRARGFTLLEVLVALAIFAMVAASVLSASARSLQNASRLEDKTLAMWIADNRLNELQLEQTPPSSGRNQGELEFAGRRWEWRTQVDSTAEQDMRRVIVWVAAKPLGRERGSIEERAAARLVGFLGSQP