Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01579

ProSeqID PSQ01579
Family FD00307
Protein Name Type II secretion system core protein G
UniProt ID Q00514
Taxonomy Bacteria-Proteobacteria-Gammaproteobacteria-Pseudomonadales-Pseudomonadaceae-Pseudomonas
Organisms Pseudomonas aeruginosa (strain ATCC 15692 , 14847
Prosequence Length (aa) 8
Functions None
Preproprotein Length (aa) 142
Alt Name General secretion pathway protein G, PilD-dependent protein PddA
Gene Name xcpT
NCBI ID 208964
Cellular Localization integral component of membrane, plasma membrane, type II protein secretion system complex
Processes protein secretion by the type II secretion system
PubMed 8331069
Total Prosequence Length (aa) 8
Prosequence Location 1:8
Prosequence Sequence MQRRQQSG
Preproprotein Sequence MQRRQQSGFTLIEIMVVVVILGILAALVVPQVMSRPDQAKVTVAKGDIKAIAAALDMYKLDNFAYPSTQQGLEALVKKPTGNPQPKNWNKDGYLKKLPVDPWGNPYQYLAPGTKGPFDLYSLGADGKEGGSDNDADIGNWDN