Details of PSQ01403
| ProSeqID |
PSQ01403 |
| Family |
FD00137 |
| Protein Name |
RNA polymerase sigma-35 factor |
| UniProt ID |
P62179
|
| Taxonomy |
Bacteria-Firmicutes-Bacilli-Bacillales-Bacillaceae-Bacillus-Bacillus-Cereus-Group |
| Organisms |
Bacillus thuringiensis subsp |
| Prosequence Length (aa) |
27 |
| Functions |
DNA binding, DNA-binding transcription factor activity, sigma factor activity |
| Preproprotein Length (aa) |
240 |
| Alt Name |
None |
| Gene Name |
sigE |
| NCBI ID |
29339 |
| Cellular Localization |
None |
| Processes |
DNA-templated transcription, initiation, sporulation resulting in formation of a cellular spore |
| PubMed |
1904859
|
| Total Prosequence Length (aa) |
27 |
| Prosequence Location |
1:27 |
| Prosequence Sequence |
MMKLKFYLVYLWYKVLLKLGIKTDEIY |
| Preproprotein Sequence |
MMKLKFYLVYLWYKVLLKLGIKTDEIYYIGGSEALPPPLTKEEEEVLLNKLPKGDQAARSLLIERNLRLVVYIARKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIKLATYASRCIENEILMHLRRNNKNRSEVSFDEPLNIDWDGNELLLSDVLGTDDDIITKDLEATVDRHLLMKALHQLNDREKQIMELRFGLAGGEEKTQKDVADMLGISQSYISRLEKRIIKRLRKEFNKMV |