Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01407

ProSeqID PSQ01407
Family FD00096
Protein Name Somatoliberin
UniProt ID P63292
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Laurasiatheria-Artiodactyla-Ruminantia-Pecora-Bovidae-Bovinae-Bos
Organisms Bos taurus (Bovine)
Prosequence Length (aa) 11
Functions growth hormone-releasing hormone activity, growth hormone-releasing hormone receptor binding, neuropeptide hormone activity, peptide hormone receptor binding
Preproprotein Length (aa) 106
Alt Name Growth hormone-releasing factor, Growth hormone-releasing hormone
Gene Name GHRH
NCBI ID 9913
Cellular Localization extracellular space, perikaryon, terminal bouton
Processes adenohypophysis development, adenylate cyclase-activating G protein-coupled receptor signaling pathway, cellular response to calcium ion, growth hormone secretion, positive regulation of cell population proliferation, positive regulation of G protein-coupled receptor signaling pathway, positive regulation of growth hormone secretion, positive regulation of insulin secretion, positive regulation of lactation, positive regulation of multicellular organism growth, response to food
PubMed 6421287
Total Prosequence Length (aa) 11
Prosequence Location 20:30
Prosequence Sequence SLPSQPLRIPR
Preproprotein Sequence MLLWVFFLVTLTLSSGSHGSLPSQPLRIPRYADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRLGRQVDGVWTDQQQMALESTLVSLLQERRNSQG