Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01028

ProSeqID PSQ01028
Family FD00092
Protein Name Interleukin-1 beta
UniProt ID P10749
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Mus-Mus
Organisms Mus musculus (Mouse)
Prosequence Length (aa) 117
Functions cytokine activity, integrin binding, interleukin-1 receptor binding, protein domain specific binding
Preproprotein Length (aa) 269
Alt Name None
Gene Name Il1b
NCBI ID 10090
Cellular Localization autophagosome, cytosol, extracellular region, extracellular space, lysosome, secretory granule, vesicle
Processes activation of MAPK activity, astrocyte activation, cellular response to drug, cellular response to lipopolysaccharide, cellular response to organic cyclic compound, cellular response to organic substance, cytokine-mediated signaling pathway, ectopic germ cell programmed cell death, extrinsic apoptotic signaling pathway in absence of ligand, fever generation, hyaluronan biosynthetic process, immune response, inflammatory response, interleukin-1-mediated signaling pathway, leukocyte migration, lipopolysaccharide-mediated signaling pathway, MAPK cascade, memory, monocyte aggregation, negative regulation of adiponectin secretion, negative regulation of branching morphogenesis of a nerve, negative regulation of cell population proliferation, negative regulation of extrinsic apoptotic signaling pathway in absence of ligand, negative regulation of gap junction assembly, negative regulation of gene expression, negative regulation of glucose transmembrane transport, negative regulation of glutamate secretion, negative regulation of insulin receptor signaling pathway, negative regulation of lipid catabolic process, negative regulation of lipid metabolic process, negative regulation of MAP kinase activity, negative regulation of neural precursor cell proliferation, negative regulation of neurogenesis, negative regulation of neuron differentiation, negative regulation of synaptic transmission, negative regulation of transcription by RNA polymerase II, neutrophil chemotaxis, positive regulation of angiogenesis, positive regulation of apoptotic process, positive regulation of astrocyte differentiation, positive regulation of calcidiol 1-monooxygenase activity, positive regulation of cell death, positive regulation of cell division, positive regulation of cell migration, positive regulation of cell population proliferation, positive regulation of chemokine production, positive regulation of complement activation, positive regulation of cytosolic calcium ion concentration, positive regulation of DNA-binding transcription factor activity, positive regulation of epithelial to mesenchymal transition, positive regulation of ERK1 and ERK2 cascade, positive regulation of fever generation, positive regulation of gene expression, positive regulation of glial cell differentiation, positive regulation of glial cell proliferation, positive regulation of granulocyte macrophage colony-stimulating factor production, positive regulation of heterotypic cell-cell adhesion, positive regulation of I-kappaB kinase/NF-kappaB signaling, positive regulation of immature T cell proliferation in thymus, positive regulation of inflammatory response, positive regulation of interferon-gamma production, positive regulation of interleukin-2 production, positive regulation of interleukin-6 production, positive regulation of interleukin-8 production, positive regulation of JNK cascade, positive regulation of JUN kinase activity, positive regulation of lipid catabolic process, positive regulation of membrane protein ectodomain proteolysis, positive regulation of mitotic nuclear division, positive regulation of monocyte chemotactic protein-1 production, positive regulation of myosin light chain kinase activity, positive regulation of neuron apoptotic process, positive regulation of neutrophil chemotaxis, positive regulation of NF-kappaB transcription factor activity, positive regulation of NIK/NF-kappaB signaling, positive regulation of nitric oxide biosynthetic process, positive regulation of p38MAPK cascade, positive regulation of phagocytosis, positive regulation of prostaglandin biosynthetic process, positive regulation of prostaglandin secretion, positive regulation of protein phosphorylation, positive regulation of RNA biosynthetic process, positive regulation of stress-activated MAPK cascade, positive regulation of T cell proliferation, positive regulation of T-helper 1 cell cytokine production, positive regulation of transcription by RNA polymerase II, positive regulation of transcription, DNA-templated, positive regulation of vascular endothelial growth factor production, protein kinase B signaling, regulation of defense response to virus by host, regulation of ERK1 and ERK2 cascade, regulation of establishment of endothelial barrier, regulation of I-kappaB kinase/NF-kappaB signaling, regulation of insulin secretion, regulation of neurogenesis, regulation of nitric-oxide synthase activity, response to ATP, response to carbohydrate, response to interleukin-1, response to lipopolysaccharide, sequestering of triglyceride, social behavior, vascular endothelial growth factor production
PubMed 2967326
Total Prosequence Length (aa) 117
Prosequence Location 1:117
Prosequence Sequence MATVPELNCEMPPFDSDENDLFFEVDGPQKMKGCFQTFDLGCPDESIQLQISQQHINKSFRQAVSLIVAVEKLWQLPVSFPWTFQDEDMSTFFSFIFEEEPILCDSWDDDDNLLVCD
Preproprotein Sequence MATVPELNCEMPPFDSDENDLFFEVDGPQKMKGCFQTFDLGCPDESIQLQISQQHINKSFRQAVSLIVAVEKLWQLPVSFPWTFQDEDMSTFFSFIFEEEPILCDSWDDDDNLLVCDVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS